Property Summary

NCBI Gene PubMed Count 50
Grant Count 12
R01 Count 4
Funding $632,514.44
PubMed Score 36.00
PubTator Score 34.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma -1.100 0.000
oligodendroglioma -1.700 0.045
ependymoma -1.700 0.000
glioblastoma 1.200 0.002
group 3 medulloblastoma -2.600 0.016
atypical teratoid/rhabdoid tumor -1.800 0.001
medulloblastoma, large-cell 1.500 0.000
Becker muscular dystrophy -1.038 0.012
type 2 diabetes -1.002 0.007
colon cancer -1.500 0.007
subependymal giant cell astrocytoma -2.102 0.043
ovarian cancer -1.300 0.000

Gene RIF (44)

PMID Text
26507551 Two African-ancestry specific variants were found to be significantly associated with metabolic syndrome S: SNP rs73989312[A] near CA10 that conferred increased risk; and SNP rs77244975[C] in CTNNA3 that conferred protection against this disease.
26188062 Copy Number Variations in CTNNA3 and RBFOX1 Associate with Pediatric Food Allergy
26073756 CTNNA3 and SEMA3D: Promising loci for asthma exacerbation identified through multiple genome-wide association studies
25345593 This study demonstrated that the copy number variations of CTNNA3 relate to opioid dependence.
24407380 CTNNA3 is not major contributor or genetic risk factor for childhood asthma but rather influence the disease expression and response to therapy.
24358122 These results suggest aberrant Claudin 7, alpha - and beta-catenin expression and/or localisation patterns may be putative markers for distinguishing localised prostate cancer from aggressive metastatic disease when used collectively.
24100690 CTNNA2 and CTNNA3 are tumor suppressor genes frequently mutated in laryngeal carcinomas.
23358160 Significant interaction with maternal CMV infection was found for rs7902091 (PSNP x CMV=7.3 x 10-7) in CTNNA3, a gene not previously implicated in schizophrenia.
23136403 Results suggest a causal relationship between CTNNA3 mutations and arrhythmogenic right ventricular cardiomyopathy
23077317 HIV-1 gp41 and alpha-catenin co-localize in gp160 and GST-alpha-catenin expressing cells; the leucine zipper-like domain (gp160 residues 791-824) of gp41 interacts strongly with the carboxy terminus (residues 795-906) of alpha-catenin
More...

AA Sequence

MSAETPITLNIDPQDLQVQTFTVEKLLEPLIIQVTTLVNCPQNPSSRKKGRSKRASVLLASVEEATWNLL      1 - 70
DKGEKIAQEATVLKDELTASLEEVRKESEALKVSAERFTDDPCFLPKREAVVQAARALLAAVTRLLILAD     71 - 140
MIDVMCLLQHVSAFQRTFESLKNVANKSDLQKTYQKLGKELENLDYLAFKRQQDLKSPNQRDEIAGARAS    141 - 210
LKENSPLLHSICSACLEHSDVASLKASKDTVCEEIQNALNVISNASQGIQNMTTPPEPQAATLGSALDEL    211 - 280
ENLIVLNPLTVTEEEIRPSLEKRLEAIISGAALLADSSCTRDLHRERIIAECNAIRQALQDLLSEYMNNA    281 - 350
GKKERSNTLNIALDNMCKKTRDLRRQLRKAIIDHVSDSFLDTTVPLLVLIEAAKNGREKEIKEYAAIFHE    351 - 420
HTSRLVEVANLACSMSTNEDGIKIVKIAANHLETLCPQIINAALALAARPKSQAVKNTMEMYKRTWENHI    421 - 490
HVLTEAVDDITSIDDFLAVSESHILEDVNKCIIALRDQDADNLDRAAGAIRGRAARVAHIVTGEMDSYEP    491 - 560
GAYTEGVMRNVNFLTSTVIPEFVTQVNVALEALSKSSLNVLDDNQFVDISKKIYDTIHDIRCSVMMIRTP    561 - 630
EELEDVSDLEEEHEVRSHTSIQTEGKTDRAKMTQLPEAEKEKIAEQVADFKKVKSKLDAEIEIWDDTSND    631 - 700
IIVLAKNMCMIMMEMTDFTRGKGPLKHTTDVIYAAKMISESGSRMDVLARQIANQCPDPSCKQDLLAYLE    701 - 770
QIKFYSHQLKICSQVKAEIQNLGGELIMSALDSVTSLIQAAKNLMNAVVQTVKMSYIASTKIIRIQSPAG    771 - 840
PRHPVVMWRMKAPAKKPLIKREKPEETCAAVRRGSAKKKIHPLQVMSEFRGRQIY                   841 - 895
//

Text Mined References (52)

PMID Year Title
26507551 2015 Genome-wide association study identifies African-ancestry specific variants for metabolic syndrome.
26188062 2015 Copy Number Variations in CTNNA3 and RBFOX1 Associate with Pediatric Food Allergy.
26073756 2015 CTNNA3 and SEMA3D: Promising loci for asthma exacerbation identified through multiple genome-wide association studies.
25345593 2015 Genome-wide association study of copy number variations (CNVs) with opioid dependence.
24407380 2014 Polymorphisms in recent GWA identified asthma genes CA10, SGK493, and CTNNA3 are associated with disease severity and treatment response in childhood asthma.
24358122 2013 The role of adhesion molecules as biomarkers for the aggressive prostate cancer phenotype.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24100690 2013 Cell-cell adhesion genes CTNNA2 and CTNNA3 are tumour suppressors frequently mutated in laryngeal carcinomas.
24023788 2013 Gene network analysis in a pediatric cohort identifies novel lung function genes.
23934736 2013 Genome-wide association study of a heart failure related metabolomic profile among African Americans in the Atherosclerosis Risk in Communities (ARIC) study.
More...