Property Summary

NCBI Gene PubMed Count 56
PubMed Score 40.40
PubTator Score 34.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (12)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 4.7e-03
Becker muscular dystrophy -1.038 1.2e-02
colon cancer -1.500 6.8e-03
ependymoma -1.700 2.5e-05
glioblastoma -1.100 4.6e-02
group 3 medulloblastoma -2.600 1.6e-02
malignant mesothelioma -1.100 3.3e-04
medulloblastoma, large-cell 1.500 1.0e-04
oligodendroglioma -1.700 4.5e-02
ovarian cancer -1.300 3.3e-09
subependymal giant cell astrocytoma -2.102 4.3e-02
type 2 diabetes -1.002 6.7e-03

Gene RIF (50)

AA Sequence

MSAETPITLNIDPQDLQVQTFTVEKLLEPLIIQVTTLVNCPQNPSSRKKGRSKRASVLLASVEEATWNLL      1 - 70
DKGEKIAQEATVLKDELTASLEEVRKESEALKVSAERFTDDPCFLPKREAVVQAARALLAAVTRLLILAD     71 - 140
MIDVMCLLQHVSAFQRTFESLKNVANKSDLQKTYQKLGKELENLDYLAFKRQQDLKSPNQRDEIAGARAS    141 - 210
LKENSPLLHSICSACLEHSDVASLKASKDTVCEEIQNALNVISNASQGIQNMTTPPEPQAATLGSALDEL    211 - 280
ENLIVLNPLTVTEEEIRPSLEKRLEAIISGAALLADSSCTRDLHRERIIAECNAIRQALQDLLSEYMNNA    281 - 350
GKKERSNTLNIALDNMCKKTRDLRRQLRKAIIDHVSDSFLDTTVPLLVLIEAAKNGREKEIKEYAAIFHE    351 - 420
HTSRLVEVANLACSMSTNEDGIKIVKIAANHLETLCPQIINAALALAARPKSQAVKNTMEMYKRTWENHI    421 - 490
HVLTEAVDDITSIDDFLAVSESHILEDVNKCIIALRDQDADNLDRAAGAIRGRAARVAHIVTGEMDSYEP    491 - 560
GAYTEGVMRNVNFLTSTVIPEFVTQVNVALEALSKSSLNVLDDNQFVDISKKIYDTIHDIRCSVMMIRTP    561 - 630
EELEDVSDLEEEHEVRSHTSIQTEGKTDRAKMTQLPEAEKEKIAEQVADFKKVKSKLDAEIEIWDDTSND    631 - 700
IIVLAKNMCMIMMEMTDFTRGKGPLKHTTDVIYAAKMISESGSRMDVLARQIANQCPDPSCKQDLLAYLE    701 - 770
QIKFYSHQLKICSQVKAEIQNLGGELIMSALDSVTSLIQAAKNLMNAVVQTVKMSYIASTKIIRIQSPAG    771 - 840
PRHPVVMWRMKAPAKKPLIKREKPEETCAAVRRGSAKKKIHPLQVMSEFRGRQIY                   841 - 895
//

Text Mined References (58)

PMID Year Title