Property Summary

NCBI Gene PubMed Count 12
PubMed Score 23.71
PubTator Score 5.60

Knowledge Summary


No data available


  Disease (1)

Disease Target Count P-value
ovarian cancer 8519 1.3e-05
Multiple myeloma 1332 3.2e-05
group 3 medulloblastoma 4104 2.4e-03


  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.100 2.4e-03
Multiple myeloma 1.030 3.2e-05
ovarian cancer 2.300 1.3e-05

Gene RIF (6)

AA Sequence

EFQNVRIIKPEASRKESSEVYFLATQYHGRKGTVKQ                                      211 - 246

Text Mined References (14)

PMID Year Title