Property Summary

NCBI Gene PubMed Count 11
Grant Count 10
R01 Count 4
Funding $2,001,099.93
PubMed Score 21.41
PubTator Score 5.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.030 0.000
group 3 medulloblastoma 1.100 0.002
ovarian cancer 2.300 0.000

Gene RIF (5)

PMID Text
25074936 Data show that 2'-O-methyltransferases MRM1, MRM2, and RNMTL1 are responsible for modification of large subunit rRNA at residues G1145, U1369, and G1370, respectively.
25009282 MRM2 and MRM3 are human mitochondrial methyltransferases involved in the modification of 16S rRNA and are important factors for the biogenesis and function of the large subunit of the mitochondrial ribosome.
24595062 FTSJ2 possesses suppressive effects on the invasion and migration of cancer cells.
20877624 Observational study of gene-disease association. (HuGE Navigator)
11827451 FTSJ2 is a nucleolar RNA methyltransferase involved in eukaryotic RNA processing and modification.

AA Sequence

MAGYLKLVCVSFQRQGFHTVGSRCKNRTGAEHLWLTRHLRDPFVKAAKVESYRCRSAFKLLEVNERHQIL      1 - 70
RPGLRVLDCGAAPGAWSQVAVQKVNAAGTDPSSPVGFVLGVDLLHIFPLEGATFLCPADVTDPRTSQRIL     71 - 140
EVLPGRRADVILSDMAPNATGFRDLDHDRLISLCLTLLSVTPDILQPGGTFLCKTWAGSQSRRLQRRLTE    141 - 210
EFQNVRIIKPEASRKESSEVYFLATQYHGRKGTVKQ                                      211 - 246
//

Text Mined References (13)

PMID Year Title
25074936 2014 Assignment of 2'-O-methyltransferases to modification sites on the mammalian mitochondrial large subunit 16 S ribosomal RNA (rRNA).
25009282 2014 MRM2 and MRM3 are involved in biogenesis of the large subunit of the mitochondrial ribosome.
24595062 2014 FTSJ2, a heat shock-inducible mitochondrial protein, suppresses cell invasion and migration.
24036117 2013 Mitochondrial ribosomal RNA (rRNA) methyltransferase family members are positioned to modify nascent rRNA in foci near the mitochondrial DNA nucleoid.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
22688191 2012 Genome-wide association study in a Swedish population yields support for greater CNV and MHC involvement in schizophrenia compared with bipolar disorder.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...