Property Summary

NCBI Gene PubMed Count 14
PubMed Score 44.92
PubTator Score 21.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

Gene RIF (7)

PMID Text
23746805 The crystal structure of the human CPA4 carboxypeptidase in complex with SmCI, a peptide protease inhibitor.
22294694 NvCL form Nerita versicolor is a tight-binding inhibitor that interacts with the active site of the CPA4 in a substrate-like manner.
20385563 CPA4 functions in neuropeptide processing and regulation in the extracellular environment
19245716 genetic polymorphism is associated with an increased risk of aggressive prostate cancer among younger patients (< 66 years)
19245716 Observational study of gene-disease association. (HuGE Navigator)
16091843 The three-dimensional structure of procarboxypeptidase-A4 (hPCPA4) has been solved and shows the features of related metallocarboxypeptidase zymogens, with a preformed alpha/beta/-hydrolase active-enzyme moiety (hCPA4) and an inhibiting pro-domain (PD).
12552318 CPA4 gene is imprinted, with preferential expression from the maternal allele in many fetal tissues, but not in fetal brain.

AA Sequence

MRWILFIGALIGSSICGQEKFFGDQVLRINVRNGDEISKLSQLVNSNNLKLNFWKSPSSFNRPVDVLVPS      1 - 70
VSLQAFKSFLRSQGLEYAVTIEDLQALLDNEDDEMQHNEGQERSSNNFNYGAYHSLEAIYHEMDNIAADF     71 - 140
PDLARRVKIGHSFENRPMYVLKFSTGKGVRRPAVWLNAGIHSREWISQATAIWTARKIVSDYQRDPAITS    141 - 210
ILEKMDIFLLPVANPDGYVYTQTQNRLWRKTRSRNPGSSCIGADPNRNWNASFAGKGASDNPCSEVYHGP    211 - 280
HANSEVEVKSVVDFIQKHGNFKGFIDLHSYSQLLMYPYGYSVKKAPDAEELDKVARLAAKALASVSGTEY    281 - 350
QVGPTCTTVYPASGSSIDWAYDNGIKFAFTFELRDTGTYGFLLPANQIIPTAEETWLGLKTIMEHVRDNL    351 - 420
Y//

Text Mined References (17)

PMID Year Title
23746805 2013 A noncanonical mechanism of carboxypeptidase inhibition revealed by the crystal structure of the Tri-Kunitz SmCI in complex with human CPA4.
22294694 2012 Crystal structure of novel metallocarboxypeptidase inhibitor from marine mollusk Nerita versicolor in complex with human carboxypeptidase A4.
20385563 2010 Characterization of the substrate specificity of human carboxypeptidase A4 and implications for a role in extracellular peptide processing.
19245716 2009 Carboxypeptidase 4 gene variants and early-onset intermediate-to-high risk prostate cancer.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16091843 2005 Detailed molecular comparison between the inhibition mode of A/B-type carboxypeptidases in the zymogen state and by the endogenous inhibitor latexin.
15738388 2005 Structure of human carboxypeptidase A4 with its endogenous protein inhibitor, latexin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
More...