Property Summary

NCBI Gene PubMed Count 27
PubMed Score 25.71
PubTator Score 29.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -3.600 9.6e-06
astrocytic glioma -3.400 6.5e-03
atypical teratoid / rhabdoid tumor -5.400 7.0e-12
ependymoma -4.700 2.1e-03
glioblastoma -3.400 2.8e-07
group 3 medulloblastoma -3.100 2.5e-03
medulloblastoma, large-cell -3.300 9.3e-04
oligodendroglioma -2.400 2.2e-02
ovarian cancer 1.200 1.8e-11
pituitary cancer 2.500 6.0e-06
primitive neuroectodermal tumor -4.800 1.4e-05

Gene RIF (12)

AA Sequence

MDLQQSTTITSLEKWCLDESLSGCRRHYSVKKKLKLIRVLGLFMGLVAISTVSFSISAFSETDTQSTGEA      1 - 70
SVVSGPRVAQGYHQRTLLDLNDKILDYTPQPPLSKEGESENSTDHAQGDYPKDIFSLEERRKGAIILHVI     71 - 140
GMIYMFIALAIVCDEFFVPSLTVITEKLGISDDVAGATFMAAGGSAPELFTSLIGVFIAHSNVGIGTIVG    141 - 210
SAVFNILFVIGMCALFSREILNLTWWPLFRDVSFYIVDLIMLIIFFLDNVIMWWESLLLLTAYFCYVVFM    211 - 280
KFNVQVEKWVKQMINRNKVVKVTAPEAQAKPSAARDKDEPTLPAKPRLQRGGSSASLHNSLMRNSIFQLM    281 - 350
IHTLDPLAEELGSYGKLKYYDTMTEEGRFREKASILHKIAKKKCHVDENERQNGAANHVEKIELPNSTST    351 - 420
DVEMTPSSDASEPVQNGNLSHNIEGAEAQTADEEEDQPLSLAWPSETRKQVTFLIVFPIVFPLWITLPDV    421 - 490
RKPSSRKFFPITFFGSITWIAVFSYLMVWWAHQVGETIGISEEIMGLTILAAGTSIPDLITSVIVARKGL    491 - 560
GDMAVSSSVGSNIFDITVGLPLPWLLYTVIHRFQPVAVSSNGLFCAIVLLFIMLLFVILSIALCKWRMNK    561 - 630
ILGFIMFGLYFVFLVVSVLLEDRILTCPVSI                                           631 - 661
//

Text Mined References (28)

PMID Year Title