Property Summary

NCBI Gene PubMed Count 71
PubMed Score 323.11
PubTator Score 47.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
active Crohn's disease 1.120 1.3e-02
active ulcerative colitis 1.367 5.7e-03
acute myeloid leukemia -1.800 3.6e-02
astrocytic glioma -1.500 1.4e-02
Astrocytoma, Pilocytic -1.600 6.7e-04
Atopic dermatitis -1.100 1.5e-02
ependymoma 2.900 5.6e-03
glioblastoma -1.100 8.3e-03
group 3 medulloblastoma 3.400 1.0e-05
lung adenocarcinoma -1.700 4.1e-16
lung cancer 2.300 2.3e-04
malignant mesothelioma 2.300 5.2e-07
medulloblastoma, large-cell 3.700 1.7e-07
non-small cell lung cancer -2.244 1.3e-19
osteosarcoma -1.297 1.3e-02
pediatric high grade glioma -1.300 3.3e-02
pituitary cancer 1.100 5.1e-03
psoriasis -1.200 1.2e-05
Rheumatoid arthritis 2.000 3.8e-04

Protein-protein Interaction (1)

Gene RIF (43)

AA Sequence

MAVPAALIPPTQLVPPQPPISTSASSSGTTTSTSSATSSPAPSIGPPASSGPTLFRPEPIASAAAAAATV      1 - 70
TSTGGGGGGGGGGSGGGGGSSGNGGGGGGGGGGSNCNPNLAAASNGSGGGGGGISAGGGVASSTPINAST     71 - 140
GSSSSSSSSSSSSSSSSSSSSSSSSCGPLPGKPVYSTPSPVENTPQNNECKMVDLRGAKVASFTVEGCEL    141 - 210
ICLPQAFDLFLKHLVGGLHTVYTKLKRLEITPVVCNVEQVRILRGLGAIQPGVNRCKLISRKDFETLYND    211 - 280
CTNASSRPGRPPKRTQSVTSPENSHIMPHSVPGLMSPGIIPPTGLTAAAAAAAAATNAAIAEAMKVKKIK    281 - 350
LEAMSNYHASNNQHGADSENGDMNSSVGSSDGSWDKETLPSSPSQGPQASITHPRMPGARSLPLSHPLNH    351 - 420
LQQSHLLPNGLELPFMMMPHPLIPVSLPPASVTMAMSQMNHLSTIANMAAAAQVQSPPSRVETSVIKERV    421 - 490
PDSPSPAPSLEEGRRPGSHPSSHRSSSVSSSPARTESSSDRIPVHQNGLSMNQMLMGLSPNVLPGPKEGD    491 - 560
LAGHDMGHESKRMHIEKDETPLSTPTARDSLDKLSLTGHGQPLPPGFPSPFLFPDGLSSIETLLTNIQGL    561 - 630
LKVAIDNARAQEKQVQLEKTELKMDFLRERELRETLEKQLAMEQKNRAIVQKRLKKEKKAKRKLQEALEF    631 - 700
ETKRREQAEQTLKQAASTDSLRVLNDSLTPEIEADRSGGRTDAERTIQDGRLYLKTTVMY              701 - 760
//

Text Mined References (70)

PMID Year Title