Property Summary

NCBI Gene PubMed Count 67
Grant Count 28
R01 Count 26
Funding $4,025,321.89
PubMed Score 303.49
PubTator Score 47.23

Knowledge Summary

Patent

No data available

Gene RIF (39)

PMID Text
25940701 DACH1 expression was reduced in hepatocellular carcinoma even at early stage and associated with tumor progression. Overexpression inhibited HCC cell growth and migration by inactivating the Wnt pathway via GSK3beta phosphorylation to suppress beta-catenin.
25788272 Kaplan-Mier analysis of human NSCLC samples demonstrated that high DACH1 mRNA levels predicted favorable prognosis for relapse-free and overall survival. In agreement, high CXCL5 expression predicted a worse prognosis for survival.
25778865 results suggest that DACH1 loss of function results in increased cell growth, motility and invasiveness through TGF-beta-mediated EMT, and DACH1 loss of function has important therapeutic implications for targeted therapies of CRC
25776071 DACH1 inhibits aldosterone secretion in human adrenals, and transforming growth factor-beta signaling pathway is activated in DACH1 overexpressed cells and may mediate inhibition of aldosterone secretion in human adrenals.
25769723 DACH1 is a determinant of benign and malignant prostate epithelium cellular growth, migration, and cytokine abundance in vivo.
25487617 Further evaluation of the methylation of DACH1, DKK1, and WIF1 in a clinical patient group confirmed the frequent methylation of WIF1 and intermediate or low frequency of methylation of DACH1 or DKK1, respectively.
25410484 In breast cancer, some GATA3 effects shift from tumor suppressing to tumor promoting during tumorigenesis, with deregulation of three genes, BCL2, DACH1, THSD4, representing major GATA3-controlled processes in cancer progression.
25322986 Results indicated that DACH1 was a novel molecular marker of RCC and it attributed to the malignant behavior of renal cancer cells.
24912879 Data indicate that dachshund family transcription factor 1 (DACH1) suppresses gastric cancer cell proliferation, invasion and metastasis by inhibiting transforming growth factor beta (TGF-beta) signalling pathways both in vitro and in vivo.
24465431 Familial young-onset diabetes, pre-diabetes and cardiovascular disease are associated with genetic variants of DACH1 in Chinese
More...

AA Sequence

MAVPAALIPPTQLVPPQPPISTSASSSGTTTSTSSATSSPAPSIGPPASSGPTLFRPEPIASAAAAAATV      1 - 70
TSTGGGGGGGGGGSGGGGGSSGNGGGGGGGGGGSNCNPNLAAASNGSGGGGGGISAGGGVASSTPINAST     71 - 140
GSSSSSSSSSSSSSSSSSSSSSSSSCGPLPGKPVYSTPSPVENTPQNNECKMVDLRGAKVASFTVEGCEL    141 - 210
ICLPQAFDLFLKHLVGGLHTVYTKLKRLEITPVVCNVEQVRILRGLGAIQPGVNRCKLISRKDFETLYND    211 - 280
CTNASSRPGRPPKRTQSVTSPENSHIMPHSVPGLMSPGIIPPTGLTAAAAAAAAATNAAIAEAMKVKKIK    281 - 350
LEAMSNYHASNNQHGADSENGDMNSSVGSSDGSWDKETLPSSPSQGPQASITHPRMPGARSLPLSHPLNH    351 - 420
LQQSHLLPNGLELPFMMMPHPLIPVSLPPASVTMAMSQMNHLSTIANMAAAAQVQSPPSRVETSVIKERV    421 - 490
PDSPSPAPSLEEGRRPGSHPSSHRSSSVSSSPARTESSSDRIPVHQNGLSMNQMLMGLSPNVLPGPKEGD    491 - 560
LAGHDMGHESKRMHIEKDETPLSTPTARDSLDKLSLTGHGQPLPPGFPSPFLFPDGLSSIETLLTNIQGL    561 - 630
LKVAIDNARAQEKQVQLEKTELKMDFLRERELRETLEKQLAMEQKNRAIVQKRLKKEKKAKRKLQEALEF    631 - 700
ETKRREQAEQTLKQAASTDSLRVLNDSLTPEIEADRSGGRTDAERTIQDGRLYLKTTVMY              701 - 760
//

Text Mined References (66)

PMID Year Title
25940701 2015 DACH1 is a novel predictive and prognostic biomarker in hepatocellular carcinoma as a negative regulator of Wnt/?-catenin signaling.
25788272 2015 DACH1 inhibits lung adenocarcinoma invasion and tumor growth by repressing CXCL5 signaling.
25778865 2015 Suppression of DACH1 promotes migration and invasion of colorectal cancer via activating TGF-?-mediated epithelial-mesenchymal transition.
25776071 2015 DACH1, a zona glomerulosa selective gene in the human adrenal, activates transforming growth factor-? signaling and suppresses aldosterone secretion.
25769723 2015 The endogenous cell-fate factor dachshund restrains prostate epithelial cell migration via repression of cytokine secretion via a cxcl signaling module.
25487617 2015 The negative regulators of Wnt pathway-DACH1, DKK1, and WIF1 are methylated in oral and oropharyngeal cancer and WIF1 methylation predicts shorter survival.
25416956 2014 A proteome-scale map of the human interactome network.
25410484 2014 Shift in GATA3 functions, and GATA3 mutations, control progression and clinical presentation in breast cancer.
25322986 2014 DACH1 inhibits cyclin D1 expression, cellular proliferation and tumor growth of renal cancer cells.
24912879 2014 Epigenetic silencing of DACH1 induces the invasion and metastasis of gastric cancer by activating TGF-? signalling.
More...