Property Summary

NCBI Gene PubMed Count 38
Grant Count 90
R01 Count 60
Funding $9,380,937.13
PubMed Score 1215.28
PubTator Score 95.36

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9UI32 B7Z8Q9 Q8IX91 Q9NYY2 Q9UI31 GLS
Symbols GA
GLS
LGA
hLGA

Gene

PANTHER Protein Class (1)

PDB

4BQM  

 GO Function (1)

Gene RIF (24)

PMID Text
26751560 As a p53 target, GLS2 mediates p53's function in metastasis suppression through inhibiting Rac1.
26647830 IDO, through GCN2 kinase activation, downregulates the levels of TCRcomplex tchain and cMyc, resulting in the suppression of Tcell proliferation and a reduction in the levels of LDHA and GLS2
25297978 GABAergic neurons and astrocytes express Gls and Gls2 isoenzymes in nucleus and mitochondria, in addition to glutamatergic neurons
24950944 Phosphate-activated glutaminase and GAD65/67 concentrations are compared in Alzheimer's disease cerebellum versus normal cerebellum controls
24797434 GLS2 expression is significantly decreased in hepatocellular carcinoma.
24330717 Epigenetic silencing of Gls2 via promoter hypermethylation is common in human liver and colon cancers.
24276018 Silencing GLS or overexpressing GLS2 induces growth inhibition in glioma cell lines.
24121663 GLS2 is acting, at least in part, downstream of p73 in neuronal differentiation and highlight a possible role of p73 in regulating neurotransmitter synthesis.
24096582 combination of negative modulation of glutaminase isoforms arising from GLS gene with the introduction of the GLS2 gene product, GAB, may in the future provide a useful means to curb glioblastoma growth in situ
23954443 The present study was to investigate the potent effect of GLS2 on radioresistance of cervical carcinoma.
More...

AA Sequence

MRSMKALQKALSRAGSHCGRGGWGHPSRSPLLGGGVRHHLSEAAAQGRETPHSHQPQHQDHDSSESGMLS      1 - 70
RLGDLLFYTIAEGQERIPIHKFTTALKATGLQTSDPRLRDCMSEMHRVVQESSSGGLLDRDLFRKCVSSN     71 - 140
IVLLTQAFRKKFVIPDFEEFTGHVDRIFEDVKELTGGKVAAYIPQLAKSNPDLWGVSLCTVDGQRHSVGH    141 - 210
TKIPFCLQSCVKPLTYAISISTLGTDYVHKFVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKM    211 - 280
DCNKAEKFDFVLQYLNKMAGNEYMGFSNATFQSEKETGDRNYAIGYYLKEKKCFPKGVDMMAALDLYFQL    281 - 350
CSVEVTCESGSVMAATLANGGICPITGESVLSAEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSAVSGA    351 - 420
ILLVVPNVMGMMCLSPPLDKLGNSHRGTSFCQKLVSLFNFHNYDNLRHCARKLDPRREGAEIRNKTVVNL    421 - 490
LFAAYSGDVSALRRFALSAMDMEQKDYDSRTALHVAAAEGHIEVVKFLIEACKVNPFAKDRWGNIPLDDA    491 - 560
VQFNHLEVVKLLQDYQDSYTLSETQAEAAAEALSKENLESMV                                561 - 602
//

Text Mined References (41)

PMID Year Title
26751560 2016 Glutaminase 2 is a novel negative regulator of small GTPase Rac1 and mediates p53 function in suppressing metastasis.
26647830 2016 Indoleamine 2,3?dioxygenase downregulates T?cell receptor complex ??chain and c?Myc, and reduces proliferation, lactate dehydrogenase levels and mitochondrial glutaminase in human T?cells.
25297978 2015 Expression of Gls and Gls2 glutaminase isoforms in astrocytes.
24950944 2014 Glutamate and GABA-metabolizing enzymes in post-mortem cerebellum in Alzheimer's disease: phosphate-activated glutaminase and glutamic acid decarboxylase.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24797434 2014 Glutaminase 2 negatively regulates the PI3K/AKT signaling and shows tumor suppression activity in human hepatocellular carcinoma.
24330717 2013 Epigenetic silencing of glutaminase 2 in human liver and colon cancers.
24276018 2014 Both GLS silencing and GLS2 overexpression synergize with oxidative stress against proliferation of glioma cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
More...