Property Summary

NCBI Gene PubMed Count 14
PubMed Score 11.72
PubTator Score 2.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Multiple myeloma 1332 1.7e-04
ovarian cancer 8520 7.3e-04
lung cancer 4740 8.2e-04
diabetes mellitus 1728 1.5e-03
Waldenstrons macroglobulinemia 765 2.7e-03
Disease Target Count Z-score Confidence
Pancytopenia 45 3.604 1.8

Expression

  Differential Expression (5)

Disease log2 FC p
diabetes mellitus -1.500 1.5e-03
lung cancer 1.200 8.2e-04
Multiple myeloma 1.748 1.7e-04
ovarian cancer -1.200 7.3e-04
Waldenstrons macroglobulinemia 1.144 2.7e-03

Synonym

Accession Q9UI30 B2R539 J3KNG5 Q3MHC7 Q8N2Z4
Symbols TRM112
HSPC152
HSPC170
hTrm112
TRMT11-2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Protein-protein Interaction (1)

Gene RIF (3)

AA Sequence

MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRLIQVPKGP      1 - 70
VEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES                    71 - 125
//

Text Mined References (20)

PMID Year Title