Property Summary

NCBI Gene PubMed Count 15
PubMed Score 5.44
PubTator Score 8.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Weight Gain 100 0.0 0.0
Disease Target Count
Alcoholic Intoxication, Chronic 289
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
lung cancer 4740 0.0 0.6
Disease Target Count Z-score Confidence
triple-A syndrome 17 4.122 2.1
Alcohol dependence 107 3.148 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
acute myeloid leukemia -1.700 4.2e-02
aldosterone-producing adenoma -1.075 2.0e-02
osteosarcoma -1.442 1.5e-05
posterior fossa group B ependymoma 1.300 3.9e-06

Gene RIF (4)

AA Sequence

MDLNSASTVVLQVLTQATSQDTAVLKPAEEQLKQWETQPGFYSVLLNIFTNHTLDINVRWLAVLYFKHGI      1 - 70
DRYWRRVAPHALSEEEKTTLRAGLITNFNEPINQIATQIAVLIAKVARLDCPRQWPELIPTLIESVKVQD     71 - 140
DLRQHRALLTFYHVTKTLASKRLAADRKLFYDLASGIYNFACSLWNHHTDTFLQEVSSGNEAAILSSLER    141 - 210
TLLSLKVLRKLTVNGFVEPHKNMEVMGFLHGIFERLKQFLECSRSIGTDNVCRDRLEKTIILFTKVLLDF    211 - 280
LDQHPFSFTPLIQRSLEFSVSYVFTEVGEGVTFERFIVQCMNLIKMIVKNYAYKPSKNFEDSSPETLEAH    281 - 350
KIKMAFFTYPTLTEICRRLVSHYFLLTEEELTMWEEDPEGFTVEETGGDSWKYSLRPCTEVLFIDIFHEY    351 - 420
NQTLTPVLLEMMQTLQGPTNVEDMNALLIKDAVYNAVGLAAYELFDSVDFDQWFKNQLLPELQVIHNRYK    421 - 490
PLRRRVIWLIGQWISVKFKSDLRPMLYEAICNLLQDQDLVVRIETATTLKLTVDDFEFRTDQFLPYLETM    491 - 560
FTLLFQLLQQVTECDTKMHVLHVLSCVIERVNMQIRPYVGCLVQYLPLLWKQSEEHNMLRCAILTTLIHL    561 - 630
VQGLGADSKNLYPFLLPVIQLSTDVSQPPHVYLLEDGLELWLVTLENSPCITPELLRIFQNMSPLLELSS    631 - 700
ENLRTCFKIINGYIFLSSTEFLQTYAVGLCQSFCELLKEITTEGQVQVLKVVENALKVNPILGPQMFQPI    701 - 770
LPYVFKGIIEGERYPVVMSTYLGVMGRVLLQNTSFFSSLLNEMAHKFNQEMDQLLGNMIEMWVDRMDNIT    771 - 840
QPERRKLSALALLSLLPSDNSVIQDKFCGIINISVEGLHDVMTEDPETGTYKDCMLMSHLEEPKVTEDEE    841 - 910
PPTEQDKRKKMLALKDPVHTVSLQQFIYEKLKAQQEMLGEQGFQSLMETVDTEIVTQLQEFLQGF         911 - 975
//

Text Mined References (20)

PMID Year Title