Knowledge Summary

Patent

No data available

Synonym

Accession Q9UI25
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MEEMSYGENSGTHVGSFSCSPQPSQQMKVLFVGNSFLLTPVLHRQPHLQPCNFGPEVVAPQRL             1 - 63
//

Text Mined References (1)

PMID Year Title
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.