Property Summary

NCBI Gene PubMed Count 9
PubMed Score 34.23
PubTator Score 13.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -2.700 3.1e-06
astrocytic glioma -2.200 2.2e-03
Astrocytoma, Pilocytic -2.300 1.3e-10
atypical teratoid / rhabdoid tumor -3.200 6.8e-06
ependymoma -3.000 2.2e-03
glioblastoma -2.300 1.3e-09
group 3 medulloblastoma -1.500 3.5e-03
lung cancer 1.200 5.3e-03
lung carcinoma 4.900 4.4e-50
medulloblastoma, large-cell -2.000 1.3e-03
oligodendroglioma -1.700 1.6e-02
Pick disease -1.500 2.3e-02
primitive neuroectodermal tumor -1.800 3.2e-02

Gene RIF (2)

AA Sequence

MANRGPSYGLSREVQEKIEQKYDADLENKLVDWIILQCAEDIEHPPPGRAHFQKWLMDGTVLCKLINSLY      1 - 70
PPGQEPIPKISESKMAFKQMEQISQFLKAAETYGVRTTDIFQTVDLWEGKDMAAVQRTLMALGSVAVTKD     71 - 140
DGCYRGEPSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGSNKGASQAGMTGYGMPRQIM               141 - 199
//

Text Mined References (9)

PMID Year Title