Property Summary

NCBI Gene PubMed Count 9
PubMed Score 32.81
PubTator Score 13.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 4.4447088507647E-50
pilocytic astrocytoma 3086 2.41555376439444E-10
adult high grade glioma 2148 3.14461317387529E-6
atypical teratoid / rhabdoid tumor 4369 6.83315007024877E-6
medulloblastoma, large-cell 6234 0.00131188371585158
ependymoma 2514 0.00224955406081365
lung cancer 4473 0.00534319651327728
astrocytoma 1493 0.010893052368329
glioblastoma 5572 0.0112268422751854
oligodendroglioma 2849 0.0159097399824116
Pick disease 1893 0.0225256521568535
medulloblastoma 1524 0.0270773975424121
primitive neuroectodermal tumor 3031 0.0321691968337787

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytoma -2.500 0.011
ependymoma -3.000 0.002
oligodendroglioma -1.700 0.016
glioblastoma -3.100 0.011
medulloblastoma -1.700 0.027
atypical teratoid / rhabdoid tumor -3.200 0.000
medulloblastoma, large-cell -2.000 0.001
primitive neuroectodermal tumor -1.800 0.032
lung cancer 1.200 0.005
adult high grade glioma -2.700 0.000
pilocytic astrocytoma -2.300 0.000
lung carcinoma 4.900 0.000
Pick disease -1.500 0.023

Synonym

Accession Q9UI15 D3DN64 Q96A74
Symbols NP22
NP24
NP25

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Rat OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (2)

PMID Text
15781144 Altered expression of hNP22 may be associated with modifications in neuronal cytoarchitecture leading to dysregulation of neural signal transduction in the anterior cingulate cortex of the schizophrenia brain.
14506410 Western blots revealed a significant increase in hNP22 protein levels in the frontal cortex but not the motor cortex of alcoholic cases.

AA Sequence

MANRGPSYGLSREVQEKIEQKYDADLENKLVDWIILQCAEDIEHPPPGRAHFQKWLMDGTVLCKLINSLY      1 - 70
PPGQEPIPKISESKMAFKQMEQISQFLKAAETYGVRTTDIFQTVDLWEGKDMAAVQRTLMALGSVAVTKD     71 - 140
DGCYRGEPSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGSNKGASQAGMTGYGMPRQIM               141 - 199
//

Text Mined References (9)

PMID Year Title
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15781144 2005 Expression of human neuronal protein 22, a novel cytoskeleton-associated protein, was decreased in the anterior cingulate cortex of schizophrenia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14506410 2003 Expression of hNP22 is altered in the frontal cortex and hippocampus of the alcoholic human brain.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107411 2002 Expressed sequence tag analysis of human retina for the NEIBank Project: retbindin, an abundant, novel retinal cDNA and alternative splicing of other retina-preferred gene transcripts.
11238712 2001 Molecular cloning and characterization of hNP22: a gene up-regulated in human alcoholic brain.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
8015377 1994 The identification of NP25: a novel protein that is differentially expressed by neuronal subpopulations.