Property Summary

NCBI Gene PubMed Count 9
PubMed Score 32.81
PubTator Score 13.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytoma -2.500 0.011
ependymoma -3.000 0.002
oligodendroglioma -1.700 0.016
glioblastoma -3.100 0.011
medulloblastoma -1.700 0.027
atypical teratoid / rhabdoid tumor -3.200 0.000
medulloblastoma, large-cell -2.000 0.001
primitive neuroectodermal tumor -1.800 0.032
lung cancer 1.200 0.005
adult high grade glioma -2.700 0.000
pilocytic astrocytoma -2.300 0.000
lung carcinoma 4.900 0.000
Pick disease -1.500 0.023

Gene RIF (2)

PMID Text
15781144 Altered expression of hNP22 may be associated with modifications in neuronal cytoarchitecture leading to dysregulation of neural signal transduction in the anterior cingulate cortex of the schizophrenia brain.
14506410 Western blots revealed a significant increase in hNP22 protein levels in the frontal cortex but not the motor cortex of alcoholic cases.

AA Sequence

MANRGPSYGLSREVQEKIEQKYDADLENKLVDWIILQCAEDIEHPPPGRAHFQKWLMDGTVLCKLINSLY      1 - 70
PPGQEPIPKISESKMAFKQMEQISQFLKAAETYGVRTTDIFQTVDLWEGKDMAAVQRTLMALGSVAVTKD     71 - 140
DGCYRGEPSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGSNKGASQAGMTGYGMPRQIM               141 - 199
//

Text Mined References (9)

PMID Year Title
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15781144 2005 Expression of human neuronal protein 22, a novel cytoskeleton-associated protein, was decreased in the anterior cingulate cortex of schizophrenia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14506410 2003 Expression of hNP22 is altered in the frontal cortex and hippocampus of the alcoholic human brain.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107411 2002 Expressed sequence tag analysis of human retina for the NEIBank Project: retbindin, an abundant, novel retinal cDNA and alternative splicing of other retina-preferred gene transcripts.
11238712 2001 Molecular cloning and characterization of hNP22: a gene up-regulated in human alcoholic brain.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
8015377 1994 The identification of NP25: a novel protein that is differentially expressed by neuronal subpopulations.