Property Summary

NCBI Gene PubMed Count 28
PubMed Score 58.35
PubTator Score 48.04

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma -1.300 3.0e-06
Multiple myeloma 1.650 4.2e-03
osteosarcoma 1.441 2.4e-04
ovarian cancer 3.000 3.2e-07
pancreatic ductal adenocarcinoma liver m... -1.703 4.4e-02
primary Sjogren syndrome -1.100 1.1e-02
psoriasis 1.400 2.4e-04

Gene RIF (12)

AA Sequence

MAAQKDQQKDAEAEGLSGTTLLPKLIPSGAGREWLERRRATIRPWSTFVDQQRFSRPRNLGELCQRLVRN      1 - 70
VEYYQSNYVFVFLGLILYCVVTSPMLLVALAVFFGACYILYLRTLESKLVLFGREVSPAHQYALAGGISF     71 - 140
PFFWLAGAGSAVFWVLGATLVVIGSHAAFHQIEAVDGEELQMEPV                             141 - 185
//

Text Mined References (30)

PMID Year Title