Property Summary

NCBI Gene PubMed Count 25
Grant Count 9
R01 Count 8
Funding $872,679.68
PubMed Score 57.83
PubTator Score 48.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 1.650 0.004
malignant mesothelioma -1.300 0.000
psoriasis 1.400 0.000
osteosarcoma 1.441 0.000
pancreatic ductal adenocarcinoma liver m... -1.703 0.044
primary Sjogren syndrome -1.100 0.011
ovarian cancer 3.000 0.000

Gene RIF (12)

PMID Text
23705972 HIV-1 gp41 colocalizes and binds to prenylated Rab acceptor 1 (PRA1)
23077317 HIV-1 gp41 colocalizes and binds to prenylated Rab acceptor 1 (PRA1)
23068607 Results suggest that NDRG2 and prenylated Rab acceptor-1 (PRA1) might act synergistically to prevent signaling of T-cell facto/beta-catenin.
21798244 Prenylated Rab acceptor protein 1 (PRA1) was identified as an interacting partner of SNCA.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20592422 These findings delineated novel roles of PRA1 in lipid transport and cell migration.
19913121 Observational study of gene-disease association. (HuGE Navigator)
16930546 in vivo modulation of PRA1 may be involved in TCF/beta-catenin signaling, as well as cellular proliferation and tumorigenesis
16917502 Coexpression of a PRA1 export mutant or knockdown of PRA1 led to redistribution of LMP1 and its associated signaling molecules to the endoplasmic reticulum and subsequent impairment of LMP1-induced NF-kappaB activation.
15914857 HIV-1 gp41 colocalizes and binds to prenylated Rab acceptor 1 (PRA1)
More...

AA Sequence

MAAQKDQQKDAEAEGLSGTTLLPKLIPSGAGREWLERRRATIRPWSTFVDQQRFSRPRNLGELCQRLVRN      1 - 70
VEYYQSNYVFVFLGLILYCVVTSPMLLVALAVFFGACYILYLRTLESKLVLFGREVSPAHQYALAGGISF     71 - 140
PFFWLAGAGSAVFWVLGATLVVIGSHAAFHQIEAVDGEELQMEPV                             141 - 185
//

Text Mined References (27)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23068607 2012 NDRG2 and PRA1 interact and synergistically inhibit T-cell factor/?-catenin signaling.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
21798244 2011 Human ?-synuclein modulates vesicle trafficking through its interaction with prenylated Rab acceptor protein 1.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20592422 2011 Proteome-wide dysregulation by PRA1 depletion delineates a role of PRA1 in lipid transport and cell migration.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19060904 2009 An empirical framework for binary interactome mapping.
More...