Property Summary

NCBI Gene PubMed Count 34
PubMed Score 18.28
PubTator Score 12.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.600 2.6e-05
astrocytic glioma -2.300 9.4e-03
Astrocytoma, Pilocytic -1.100 4.7e-05
atypical teratoid / rhabdoid tumor -1.700 3.5e-08
ependymoma -2.300 1.6e-02
glioblastoma -1.100 2.3e-05
medulloblastoma -1.500 5.7e-05
medulloblastoma, large-cell -1.800 1.8e-04
Multiple myeloma 1.130 8.5e-03
oligodendroglioma -1.500 4.3e-02
ovarian cancer 1.600 3.3e-04
Pick disease -1.400 9.8e-04
primitive neuroectodermal tumor -1.300 8.7e-04

Protein-protein Interaction (1)

Gene RIF (11)

AA Sequence

MTKMDIRGAVDAAVPTNIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEMKRSPEEKQEMLQTEG      1 - 70
SQCAKTFINLMTHICKEQTVQYILTMVDDMLQENHQRVSIFFDYARCSKNTAWPYFLPMLNRQDPFTVHM     71 - 140
AARIIAKLAAWGKELMEGSDLNYYFNWIKTQLSSQKLRGSGVAVETGTVSSSDSSQYVQCVAGCLQLMLR    141 - 210
VNEYRFAWVEADGVNCIMGVLSNKCGFQLQYQMIFSIWLLAFSPQMCEHLRRYNIIPVLSDILQESVKEK    211 - 280
VTRIILAAFRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLS    281 - 350
SFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAVAAHDVGEYVRH    351 - 420
YPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMVHNWEYLGKQLQSEQPQTAAARS           421 - 483
//

Text Mined References (37)

PMID Year Title