Property Summary

NCBI Gene PubMed Count 32
PubMed Score 16.74
PubTator Score 12.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 3.52307858338781E-8
adult high grade glioma 2148 2.63314311508568E-5
pilocytic astrocytoma 3086 5.59788741983565E-5
medulloblastoma 1524 5.68244420372573E-5
medulloblastoma, large-cell 6234 1.76580063944119E-4
ovarian cancer 8492 3.29240144856767E-4
primitive neuroectodermal tumor 3031 8.71266349515301E-4
Pick disease 1893 9.81677717875378E-4
glioblastoma 5572 0.00318044101991988
Multiple myeloma 1328 0.00853976537262773
astrocytic glioma 2241 0.00935046659074086
ependymoma 2514 0.0158565968848545
oligodendroglioma 2849 0.0429556391826284

Expression

  Differential Expression (13)

Disease log2 FC p
Multiple myeloma 1.130 0.009
astrocytic glioma -2.300 0.009
ependymoma -2.300 0.016
oligodendroglioma -1.500 0.043
glioblastoma -1.600 0.003
atypical teratoid / rhabdoid tumor -1.700 0.000
medulloblastoma -1.500 0.000
medulloblastoma, large-cell -1.800 0.000
primitive neuroectodermal tumor -1.300 0.001
adult high grade glioma -1.600 0.000
pilocytic astrocytoma -1.100 0.000
Pick disease -1.400 0.001
ovarian cancer 1.600 0.000

Synonym

Accession Q9UI12 B3KMR0 Q6PK44 Q9H3E3 Q9Y300 V-ATPase subunit H
Symbols SFD
NBP1
VMA13
CGI-11
MSTP042
SFDbeta
SFDalpha

Gene

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid
Fruitfly OMA EggNOG Inparanoid

Gene RIF (9)

PMID Text
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
21871445 ATP6V1H may represent a critical molecular mechanism involved in the development of type 2 diabetes and its compilations through its important regulatory effect on vacuolar-ATPase activity.
20488787 HIV-1 Nef-induced activation of p61Hck is required for the formation of multinucleated giant cells (MGCs), which is dependent on lysosomal proteins including vacuolar adenosine triphosphatase and proteases participated in Nef-induced MGCs
19815536 Data show that the BCG phagosome is relatively depleted in LAMP-2, NPC1, flotillin-1, vATPase, and syntaxin 3.
18368028 Our study shows that multiple mechanisms of pump dysfunction result from B1 subunit mutations with a common outcome being defective assembly
12058068 HIV-1 Nef-induced activation of p61Hck is required for the formation of multinucleated giant cells (MGCs), which is dependent on lysosomal proteins including vacuolar adenosine triphosphatase and proteases participated in Nef-induced MGCs
12032142 HIV-1 Nef-induced activation of p61Hck is required for the formation of multinucleated giant cells (MGCs), which is dependent on lysosomal proteins including vacuolar adenosine triphosphatase and proteases participated in Nef-induced MGCs
11463741 HIV-1 Nef-induced activation of p61Hck is required for the formation of multinucleated giant cells (MGCs), which is dependent on lysosomal proteins including vacuolar adenosine triphosphatase and proteases participated in Nef-induced MGCs
9620685 HIV-1 Nef-induced activation of p61Hck is required for the formation of multinucleated giant cells (MGCs), which is dependent on lysosomal proteins including vacuolar adenosine triphosphatase and proteases participated in Nef-induced MGCs

AA Sequence

MTKMDIRGAVDAAVPTNIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEMKRSPEEKQEMLQTEG      1 - 70
SQCAKTFINLMTHICKEQTVQYILTMVDDMLQENHQRVSIFFDYARCSKNTAWPYFLPMLNRQDPFTVHM     71 - 140
AARIIAKLAAWGKELMEGSDLNYYFNWIKTQLSSQKLRGSGVAVETGTVSSSDSSQYVQCVAGCLQLMLR    141 - 210
VNEYRFAWVEADGVNCIMGVLSNKCGFQLQYQMIFSIWLLAFSPQMCEHLRRYNIIPVLSDILQESVKEK    211 - 280
VTRIILAAFRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLS    281 - 350
SFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAVAAHDVGEYVRH    351 - 420
YPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMVHNWEYLGKQLQSEQPQTAAARS           421 - 483
//

Text Mined References (35)

PMID Year Title
25659576 2015 TM9SF4 is a novel V-ATPase-interacting protein that modulates tumor pH alterations associated with drug resistance and invasiveness of colon cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23092984 2012 Genome-wide association of mood-incongruent psychotic bipolar disorder.
22982048 2012 Lipofuscin is formed independently of macroautophagy and lysosomal activity in stress-induced prematurely senescent human fibroblasts.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
21871445 2011 Decreased expression of ATP6V1H in type 2 diabetes: a pilot report on the diabetes risk study in Mexican Americans.
21269460 2011 Initial characterization of the human central proteome.
19815536 2010 The Mycobacterium bovis bacille Calmette-Guerin phagosome proteome.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
More...