Property Summary

NCBI Gene PubMed Count 44
PubMed Score 10.82
PubTator Score 95.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.427 0.000
lung cancer 1.500 0.000
ovarian cancer 1.500 0.000

Synonym

Accession Q9UI10 Q53RY7 Q5BJF4 Q9BUV9 Q9UBG4 Q9UIQ9 Q9UJ95
Symbols EIF2B
EIF-2B
EIF2Bdelta

Gene

Gene RIF (19)

PMID Text
25779044 demonstrate that DAP5 associates with eIF2beta and eIF4AI to stimulate IRES-dependent translation of cellular mRNAs
25600065 A novel missense mutation within EIF2B4 is associated with vanishing white matter disease.
22737209 analysis of developmental splicing deregulation in leukodystrophies related to EIF2B mutations
21560189 The functional effects of selected vanishing white matter disease mutations in EIF2B2-5 by coexpressing mutated and wild-type subunits in human cells.
21503715 A mutation .626G>A [p.Arg209Gln] in exon 7 and c.1399C>T [p.Arg467Trp] in exon 13 of the EIF2B4-Gens.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20709751 Data demonstrate that cellular response resulting from eIF2alpha phosphorylation is attenuated in several cancer cell lines, and correlates with the expression of a specific isoform of a regulatory eIF2B subunit, eIF2Bdelta variant 1 (V1).
20532202 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20016818 These results validate the measurement of eIF2B GEF activity in patients' transformed-lymphocytes as an important tool for the diagnosis of eIF2B-related disorders.
19460752 Knockdown of eukaryotic translation initiation factor 2B, subunit 4 delta (EIF2B4, 67kDa) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
More...

AA Sequence

MAAVAVAVREDSGSGMKAELPPGPGAVGREMTKEEKLQLRKEKKQQKKKRKEEKGAEPETGSAVSAAQCQ      1 - 70
VGPTRELPESGIQLGTPREKVPAGRSKAELRAERRAKQEAERALKQARKGEQGGPPPKASPSTAGETPSG     71 - 140
VKRLPEYPQVDDLLLRRLVKKPERQQVPTRKDYGSKVSLFSHLPQYSRQNSLTQFMSIPSSVIHPAMVRL    141 - 210
GLQYSQGLVSGSNARCIALLRALQQVIQDYTTPPNEELSRDLVNKLKPYMSFLTQCRPLSASMHNAIKFL    211 - 280
NKEITSVGSSKREEEAKSELRAAIDRYVQEKIVLAAQAISRFAYQKISNGDVILVYGCSSLVSRILQEAW    281 - 350
TEGRRFRVVVVDSRPWLEGRHTLRSLVHAGVPASYLLIPAASYVLPEVSKVLLGAHALLANGSVMSRVGT    351 - 420
AQLALVARAHNVPVLVCCETYKFCERVQTDAFVSNELDDPDDLQCKRGEHVALANWQNHASLRLLNLVYD    421 - 490
VTPPELVDLVITELGMIPCSSVPVVLRVKSSDQ                                         491 - 523
//

Text Mined References (53)

PMID Year Title
26043506 2015 A rare mutation in EIF2B4 gene in an epileptic child with vanishing white matter disease: a case report.
25875391 2015 Pharmacological dimerization and activation of the exchange factor eIF2B antagonizes the integrated stress response.
25779044 2015 DAP5 associates with eIF2? and eIF4AI to promote Internal Ribosome Entry Site driven translation.
25600065 2015 Adult-onset vanishing white matter disease with novel missense mutations in a subunit of translational regulator, EIF2B4.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22737209 2012 Developmental splicing deregulation in leukodystrophies related to EIF2B mutations.
More...