Property Summary

Ligand Count 1
NCBI Gene PubMed Count 16
PubMed Score 9.07
PubTator Score 4.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Gene RIF (3)

AA Sequence

MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHRWVVYTTEMNG      1 - 70
KNTFWDVDGSMVPPEWHRWLHSMTDDPPTTKPLTARKFIWTNHKFNVTGTPEQYVPYSTTRKKIQEWIPP     71 - 140
STPYK                                                                     141 - 145
//

Text Mined References (20)

PMID Year Title