Property Summary

NCBI Gene PubMed Count 36
Grant Count 5
R01 Count 5
Funding $434,535.8
PubMed Score 158.01
PubTator Score 28.58

Knowledge Summary

Patent

No data available

Expression

Gene RIF (12)

PMID Text
22190034 HIV-1 gp120 is identified to have a physical interaction with Enah/Vasp-like (EVL) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21398369 ENA/VASP-family proteins are functionally redundant in homologous recombination, and MENA, VASP and EVL may be involved in the DSB repair pathway in humans
20639531 EVL, with either E. coli topoisomerase I or human topoisomerase IIIalpha, catalyzed ssDNA catenation.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19725871 EVH2 domain, which is highly conserved among the ENA/VASP family proteins, may be responsible for the recombination function of EVL.
19329439 EVL protein is a novel recombination factor that may be required for repairing specific DNA lesions, and that may cause tumor malignancy by its inappropriate expression.
18357390 EVL may be implicated in invasion and/or metastasis of human breast cancer.
18264139 A microRNA encoded in an intron of the gene EVL, is commonly suppressed in human colorectal cancer.
17998398 EVL is required for endothelial barrier function in vivo.
16376568 Data suggest that ena/VASP binding to F-actin allows for gephyrin recruitment to the leading edge of uncapped actin filaments.
More...

AA Sequence

MSEQSICQARASVMVYDDTSKKWVPIKPGQQGFSRINIYHNTASNTFRVVGVKLQDQQVVINYSIVKGLK      1 - 70
YNQATPTFHQWRDARQVYGLNFASKEEATTFSNAMLFALNIMNSQEGGPSSQRQVQNGPSPDEMDIQRRQ     71 - 140
VMEQHQQQRQESLERRTSATGPILPPGHPSSAASAPVSCSGPPPPPPPPVPPPPTGATPPPPPPLPAGGA    141 - 210
QGSSHDESSMSGLAAAIAGAKLRRVQRPEDASGGSSPSGTSKSDANRASSGGGGGGLMEEMNKLLAKRRK    211 - 280
AASQSDKPAEKKEDESQMEDPSTSPSPGTRAASQPPNSSEAGRKPWERSNSVEKPVSSILSRTPSVAKSP    281 - 350
EAKSPLQSQPHSRMKPAGSVNDMALDAFDLDRMKQEILEEVVRELHKVKEEIIDAIRQELSGISTT        351 - 416
//

Text Mined References (48)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24705354 2014 The palmitoyl acyltransferase HIP14 shares a high proportion of interactors with huntingtin: implications for a role in the pathogenesis of Huntington's disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23275563 2013 Development and application of a DNA microarray-based yeast two-hybrid system.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23153535 2012 Differential remodeling of actin cytoskeleton architecture by profilin isoforms leads to distinct effects on cell migration and invasion.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21398369 2011 Biochemical analysis of the human ENA/VASP-family proteins, MENA, VASP and EVL, in homologous recombination.
21269460 2011 Initial characterization of the human central proteome.
20639531 2010 Single-stranded DNA catenation mediated by human EVL and a type I topoisomerase.
More...