Property Summary

NCBI Gene PubMed Count 101
PubMed Score 0.00
PubTator Score 30.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
osteosarcoma 7933 8.17096041237123E-11
psoriasis 6685 1.64780190805517E-9
juvenile dermatomyositis 1189 2.5434532053772E-7
non-small cell lung cancer 2798 7.66244620338668E-7
ovarian cancer 8492 8.70426630344699E-4
medulloblastoma, large-cell 6234 0.00110195141343165
ulcerative colitis 2087 0.00160039468853712
gastric cancer 436 0.00236851905517327
adrenocortical adenoma 134 0.00305715257723077
diabetes mellitus 1663 0.00408276088048225
Pick disease 1893 0.0059048864612158
COPD 116 0.00875151600412619
Rheumatoid Arthritis 1171 0.0121688764476634
invasive ductal carcinoma 2950 0.0146261797903996
glioblastoma 5572 0.0189116406269174
Becker muscular dystrophy 187 0.0209434769132379
acute quadriplegic myopathy 1157 0.0214694922470886
ductal carcinoma in situ 1745 0.0267962428688166
non primary Sjogren syndrome sicca 840 0.0271804781717142
Amyotrophic Lateral Sclerosis 432 0.0334405723650151
astrocytic glioma 2241 0.0336165491053087
acute myeloid leukemia 785 0.0341797265965141
pancreatic cancer 2300 0.0347274011100926
pancreatic carcinoma 567 0.0347274011100926
ependymoma 2514 0.0356321444012561
medulloblastoma 1524 0.0383914147701341
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0386816140217457
limb girdle muscular dystrophy 2A 156 0.0445509229167612
oligodendroglioma 2849 0.0461318558739315
subependymal giant cell astrocytoma 2287 0.0461949758858777
Disease Target Count Z-score Confidence
lung cancer 4473 5.052 2.5
Sinoatrial node disease 7 3.741 1.9
Epilepsy 346 3.409 1.7

Gene RIF (78)

PMID Text
26926567 miR-1 bound both MALAT1 and cdc42 3'UTR directly. Further study showed that MALAT1 induced migration and invasion of breast cancer cells while reduced the level of cdc42.
26854446 robust correlation could be obtained between MALAT-1 overexpression with lymph node metastasis, tumor differentiation and clinical stage
26826711 Natural antisense RNA promotes 3' end processing and maturation of MALAT1 lncRNA.
26821178 The overexpression of MALAT-1 may be a potential prognostic indicator for various human cancers.
26782531 An elevated MALAT1 expression correlates with large tumor size, advanced tumor stage, and poor prognosis, and might therefore be utilized to evaluate clinical pathological features and prognostic outcome for cancer patients. (Meta-analysis)
26722461 MALAT-1 may play an important role in the regulation of proliferation, cell cycle, apoptosis, migration and invasion of trophoblast cells, and under-expression of MALAT-1 during early placentation may be involved in the pathogenesis of preeclampsia.
26634309 Using drugs that specifically inhibit or activate the PERK or IRE1alpha sensors, we demonstrate that signalling through the PERK axis activates this expression, through a transcriptional mechanism
26619802 there was reciprocal repression between MALAT1 and miR-140, and miR-140 mediated the effects that MALAT1 knockdown exerted
26614531 MALAT1 level is associated with liver damage, and has clinical utility for predicting development of hepatocellular carcinoma
26522444 MALAT1 is an important prognostic factor and therapeutic target for OSCC.
More...

AA Sequence

MQIMFSSVVRISGLCLFPNGGMTYNLFCLYLSIHQGAVFSASRPSYCQAGYDSEDVI                   1 - 57
//

Text Mined References (101)

PMID Year Title
27872311 2016 Methyltransferase-like protein 16 binds the 3'-terminal triple helix of MALAT1 long noncoding RNA.
27862640 2017 Long non-coding RNA MALAT1 functions as a mediator in cardioprotective effects of fentanyl in myocardial ischemia-reperfusion injury.
27841943 2016 MALAT1 in human adipose stem cells modulates survival and alternative splicing of PKC?II in HT22 cells.
27814602 2017 MALAT1-mediated tumorigenesis.
27782152 2016 HULC cooperates with MALAT1 to aggravate liver cancer stem cells growth through telomere repeat-binding factor 2.
27693631 2016 Disrupting MALAT1/miR-200c sponge decreases invasion and migration in endometrioid endometrial carcinoma.
27374227 2016 Long non-coding RNA Malat1 promotes neurite outgrowth through activation of ERK/MAPK signalling pathway in N2a cells.
27250026 2016 Functional and prognostic significance of long non-coding RNA MALAT1 as a metastasis driver in ER negative lymph node negative breast cancer.
26926567 2016 MALAT1 induced migration and invasion of human breast cancer cells by competitively binding miR-1 with cdc42.
26854446 Human MALAT-1 long non-coding RNA is overexpressed in cervical cancer metastasis and promotes cell proliferation, invasion and migration.
More...