Property Summary

NCBI Gene PubMed Count 101
PubMed Score 0.00
PubTator Score 30.13

Knowledge Summary

Patent

No data available

Gene RIF (78)

PMID Text
26926567 miR-1 bound both MALAT1 and cdc42 3'UTR directly. Further study showed that MALAT1 induced migration and invasion of breast cancer cells while reduced the level of cdc42.
26854446 robust correlation could be obtained between MALAT-1 overexpression with lymph node metastasis, tumor differentiation and clinical stage
26826711 Natural antisense RNA promotes 3' end processing and maturation of MALAT1 lncRNA.
26821178 The overexpression of MALAT-1 may be a potential prognostic indicator for various human cancers.
26782531 An elevated MALAT1 expression correlates with large tumor size, advanced tumor stage, and poor prognosis, and might therefore be utilized to evaluate clinical pathological features and prognostic outcome for cancer patients. (Meta-analysis)
26722461 MALAT-1 may play an important role in the regulation of proliferation, cell cycle, apoptosis, migration and invasion of trophoblast cells, and under-expression of MALAT-1 during early placentation may be involved in the pathogenesis of preeclampsia.
26634309 Using drugs that specifically inhibit or activate the PERK or IRE1alpha sensors, we demonstrate that signalling through the PERK axis activates this expression, through a transcriptional mechanism
26619802 there was reciprocal repression between MALAT1 and miR-140, and miR-140 mediated the effects that MALAT1 knockdown exerted
26614531 MALAT1 level is associated with liver damage, and has clinical utility for predicting development of hepatocellular carcinoma
26522444 MALAT1 is an important prognostic factor and therapeutic target for OSCC.
More...

AA Sequence

MQIMFSSVVRISGLCLFPNGGMTYNLFCLYLSIHQGAVFSASRPSYCQAGYDSEDVI                   1 - 57
//

Text Mined References (101)

PMID Year Title
27872311 2016 Methyltransferase-like protein 16 binds the 3'-terminal triple helix of MALAT1 long noncoding RNA.
27862640 2017 Long non-coding RNA MALAT1 functions as a mediator in cardioprotective effects of fentanyl in myocardial ischemia-reperfusion injury.
27841943 2016 MALAT1 in human adipose stem cells modulates survival and alternative splicing of PKC?II in HT22 cells.
27814602 2017 MALAT1-mediated tumorigenesis.
27782152 2016 HULC cooperates with MALAT1 to aggravate liver cancer stem cells growth through telomere repeat-binding factor 2.
27693631 2016 Disrupting MALAT1/miR-200c sponge decreases invasion and migration in endometrioid endometrial carcinoma.
27374227 2016 Long non-coding RNA Malat1 promotes neurite outgrowth through activation of ERK/MAPK signalling pathway in N2a cells.
27250026 2016 Functional and prognostic significance of long non-coding RNA MALAT1 as a metastasis driver in ER negative lymph node negative breast cancer.
26926567 2016 MALAT1 induced migration and invasion of human breast cancer cells by competitively binding miR-1 with cdc42.
26854446 Human MALAT-1 long non-coding RNA is overexpressed in cervical cancer metastasis and promotes cell proliferation, invasion and migration.
More...