Property Summary

NCBI Gene PubMed Count 7
PubMed Score 9.96
PubTator Score 13.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
medulloblastoma 720 6.1e-05
medulloblastoma, large-cell 6241 2.4e-04
lung cancer 4740 8.0e-04
invasive ductal carcinoma 2951 4.9e-03
Multiple myeloma 1332 1.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Chromosome 4q21 deletion syndrome 6 5.58 2.8

Expression

  Differential Expression (5)

Disease log2 FC p
invasive ductal carcinoma 1.200 4.9e-03
lung cancer 1.200 8.0e-04
medulloblastoma -1.200 6.1e-05
medulloblastoma, large-cell -1.100 2.4e-04
Multiple myeloma 1.108 1.7e-02

Protein-protein Interaction (4)

Gene RIF (1)

AA Sequence

MVVLSVPAEVTVILLDIEGTTTPIAFVKDILFPYIEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLD      1 - 70
GAVPIPAASGNGVDDLQQMIQAVVDNVCWQMSLDRKTTALKQLQGHMWRAAFTAGRMKAEFFADVVPAVR     71 - 140
KWREAGMKVYIYSSGSVEAQKLLFGHSTEGDILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFL    141 - 210
TDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYLPSST                       211 - 261
//

Text Mined References (8)

PMID Year Title