Property Summary

NCBI Gene PubMed Count 7
PubMed Score 9.46
PubTator Score 13.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.108 0.017
medulloblastoma -1.200 0.000
medulloblastoma, large-cell -1.100 0.000
lung cancer 1.400 0.000
invasive ductal carcinoma 1.200 0.005

Synonym

Accession Q9UHY7 Q7Z4C5 Q9BVC2
Symbols E1
MASA
mtnC
MST145

Gene

PANTHER Protein Class (2)

PDB

1YNS   1ZS9  

Gene RIF (1)

PMID Text
15843022 the crystal structure of MASA and its complex with a substrate analog

AA Sequence

MVVLSVPAEVTVILLDIEGTTTPIAFVKDILFPYIEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLD      1 - 70
GAVPIPAASGNGVDDLQQMIQAVVDNVCWQMSLDRKTTALKQLQGHMWRAAFTAGRMKAEFFADVVPAVR     71 - 140
KWREAGMKVYIYSSGSVEAQKLLFGHSTEGDILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFL    141 - 210
TDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYLPSST                       211 - 261
//

Text Mined References (8)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15843022 2005 Crystal structure of human E1 enzyme and its complex with a substrate analog reveals the mechanism of its phosphatase/enolase activity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.