Property Summary

NCBI Gene PubMed Count 24
Grant Count 41
R01 Count 23
Funding $5,463,061.57
PubMed Score 9.04
PubTator Score 30.10

Knowledge Summary

Patent (2,028)

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
acute myeloid leukemia 1.200 0.023

Gene RIF (10)

PMID Text
24910013 The present study deals with the molecular modeling of the viral protein (NS3 of DENV1-4), the host protein (NRBP) and their interactions through protein-protein docking study.
24447338 The amplified luminescent proximity homogeneous assay (AlphaScreen) identifies the interaction of HIV-1 Gag with NRBP1
24372240 Targeting this we performed homology modeling and protein-protein docking study of NS3 with NRBP (Nuclear Receptor Binding Protein) of human as it has been proved that NS3 of DENV interacts with NRBP which causes cellular trafficking in human cell.
22510880 It was shown that NRBP1 is a tumour suppressor that plays a critical role in intestinal cell homoeostasis. NRBP1 levels are reduced in a wide variety of human tumours. Reduced NRBP1 levels in lung cancer correlates with a poor prognosis.
22473923 High NRBP1 expression in prostate cancer is linked with poor clinical outcomes and increased cancer cell growth.
18976975 Knockdown of nuclear receptor binding protein 1 (NRBP1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
17052710 NRBP may be an important negative regulator of Jab1-mediated functions such as gene transcription and tumor progression.
15084397 NS3 protein of dengue virus type 2 interacted specifically with nuclear receptor binding protein, a host cellular protein that influences trafficking between the endoplasmic reticulum and Golgi, and that interacts with Rac3
12176995 mediates phosphorylation of the 14-3-3 binding site of myeloid leukemia factor 1
11956649 Interaction of the small GTPase Rac3 with NRBP: results suggest that NRBP functions in subcellular trafficking and may be directed to specific subcellular locations through interaction with small GTPases of the Rho family

AA Sequence

MSEGESQTVLSSGSDPKVESSSSAPGLTSVSPPVTSTTSAASPEEEEESEDESEILEESPCGRWQKRREE      1 - 70
VNQRNVPGIDSAYLAMDTEEGVEVVWNEVQFSERKNYKLQEEKVRAVFDNLIQLEHLNIVKFHKYWADIK     71 - 140
ENKARVIFITEYMSSGSLKQFLKKTKKNHKTMNEKAWKRWCTQILSALSYLHSCDPPIIHGNLTCDTIFI    141 - 210
QHNGLIKIGSVAPDTINNHVKTCREEQKNLHFFAPEYGEVTNVTTAVDIYSFGMCALEMAVLEIQGNGES    211 - 280
SYVPQEAISSAIQLLEDPLQREFIQKCLQSEPARRPTARELLFHPALFEVPSLKLLAAHCIVGHQHMIPE    281 - 350
NALEEITKNMDTSAVLAEIPAGPGREPVQTLYSQSPALELDKFLEDVRNGIYPLTAFGLPRPQQPQQEEV    351 - 420
TSPVVPPSVKTPTPEPAEVETRKVVLMQCNIESVEEGVKHHLTLLLKLEDKLNRHLSCDLMPNENIPELA    421 - 490
AELVQLGFISEADQSRLTSLLEETLNKFNFARNSTLNSAAVTVSS                             491 - 535
//

Text Mined References (35)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24910013 2014 Insight into structural organization and protein-protein interaction of non structural 3 (NS3) proteins from dengue serotypes.
24372240 2013 Design, virtual screening and docking study of novel NS3 inhibitors by targeting protein-protein interacting sites of dengue virus - a novel approach.
23505323 2013 Genomic study in Mexicans identifies a new locus for triglycerides and refines European lipid loci.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22510880 2012 Nuclear receptor binding protein 1 regulates intestinal progenitor cell homeostasis and tumour formation.
22473923 2012 High NRBP1 expression in prostate cancer is linked with poor clinical outcomes and increased cancer cell growth.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...