Property Summary

NCBI Gene PubMed Count 24
PubMed Score 10.39
PubTator Score 30.10

Knowledge Summary

Patent (2,028)

TINX Plot

  Disease (3)

Disease Target Count P-value
acute myeloid leukemia 783 2.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Juvenile spinal muscular atrophy 4 4.285 2.1
Bell's palsy 2 3.642 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
acute myeloid leukemia 1.200 2.3e-02

Gene RIF (10)

AA Sequence

MSEGESQTVLSSGSDPKVESSSSAPGLTSVSPPVTSTTSAASPEEEEESEDESEILEESPCGRWQKRREE      1 - 70
VNQRNVPGIDSAYLAMDTEEGVEVVWNEVQFSERKNYKLQEEKVRAVFDNLIQLEHLNIVKFHKYWADIK     71 - 140
ENKARVIFITEYMSSGSLKQFLKKTKKNHKTMNEKAWKRWCTQILSALSYLHSCDPPIIHGNLTCDTIFI    141 - 210
QHNGLIKIGSVAPDTINNHVKTCREEQKNLHFFAPEYGEVTNVTTAVDIYSFGMCALEMAVLEIQGNGES    211 - 280
SYVPQEAISSAIQLLEDPLQREFIQKCLQSEPARRPTARELLFHPALFEVPSLKLLAAHCIVGHQHMIPE    281 - 350
NALEEITKNMDTSAVLAEIPAGPGREPVQTLYSQSPALELDKFLEDVRNGIYPLTAFGLPRPQQPQQEEV    351 - 420
TSPVVPPSVKTPTPEPAEVETRKVVLMQCNIESVEEGVKHHLTLLLKLEDKLNRHLSCDLMPNENIPELA    421 - 490
AELVQLGFISEADQSRLTSLLEETLNKFNFARNSTLNSAAVTVSS                             491 - 535
//

Text Mined References (35)

PMID Year Title