Property Summary

NCBI Gene PubMed Count 33
PubMed Score 48.24
PubTator Score 38.14

Knowledge Summary

Patent (4,278)

TINX Plot

  Disease (6)

Expression

  Differential Expression (7)

Disease log2 FC p
Breast cancer 2.800 2.5e-02
glioblastoma 1.200 8.3e-05
head and neck cancer and chronic obstruc... 1.300 1.7e-03
interstitial cystitis 1.200 1.2e-02
lung carcinoma -1.300 1.4e-14
pediatric high grade glioma 1.400 5.8e-04
ulcerative colitis 2.400 2.7e-06

Gene RIF (14)

AA Sequence

MGGRVFLVFLAFCVWLTLPGAETQDSRGCARWCPQDSSCVNATACRCNPGFSSFSEIITTPMETCDDINE      1 - 70
CATLSKVSCGKFSDCWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDVDECQQNPRLCKSYGTCVNTL     71 - 140
GSYTCQCLPGFKLKPEDPKLCTDVNECTSGQNPCHSSTHCLNNVGSYQCRCRPGWQPIPGSPNGPNNTVC    141 - 210
EDVDECSSGQHQCDSSTVCFNTVGSYSCRCRPGWKPRHGIPNNQKDTVCEDMTFSTWTPPPGVHSQTLSR    211 - 280
FFDKVQDLGRDYKPGLANNTIQSILQALDELLEAPGDLETLPRLQQHCVASHLLDGLEDVLRGLSKNLSN    281 - 350
GLLNFSYPAGTELSLEVQKQVDRSVTLRQNQAVMQLDWNQAQKSGDPGPSVVGLVSIPGMGKLLAEAPLV    351 - 420
LEPEKQMLLHETHQGLLQDGSPILLSDVISAFLSNNDTQNLSSPVTFTFSHRSVIPRQKVLCVFWEHGQN    421 - 490
GCGHWATTGCSTIGTRDTSTICRCTHLSSFAVLMAHYDVQEEDPVLTVITYMGLSVSLLCLLLAALTFLL    491 - 560
CKAIQNTSTSLHLQLSLCLFLAHLLFLVAIDQTGHKVLCSIIAGTLHYLYLATLTWMLLEALYLFLTARN    561 - 630
LTVVNYSSINRFMKKLMFPVGYGVPAVTVAISAASRPHLYGTPSRCWLQPEKGFIWGFLGPVCAIFSVNL    631 - 700
VLFLVTLWILKNRLSSLNSEVSTLRNTRMLAFKATAQLFILGCTWCLGILQVGPAARVMAYLFTIINSLQ    701 - 770
GVFIFLVYCLLSQQVREQYGKWSKGIRKLKTESEMHTLSSSAKADTSKPSTVN                     771 - 823
//

Text Mined References (34)

PMID Year Title