Property Summary

NCBI Gene PubMed Count 33
Grant Count 1
Funding $500,000
PubMed Score 43.71
PubTator Score 38.14

Knowledge Summary

Patent (4,278)

Expression

  Differential Expression (7)

Disease log2 FC p
glioblastoma 1.600 0.005
Breast cancer 2.800 0.025
interstitial cystitis 1.700 0.000
pediatric high grade glioma 1.400 0.001
lung carcinoma -1.300 0.000
ulcerative colitis 2.400 0.000
head and neck cancer and chronic obstruc... 1.300 0.002

Synonym

Accession Q9UHX3 B4DQ96 E7ESD7 E9PBR1 E9PEL6 E9PFQ5 E9PG91 Q8NG96 Q9Y4B1
Symbols VBU
EMR2
CD312

Gene

 Grant Application (1)

PDB

2BO2   2BOU   2BOX  

Gene RIF (14)

PMID Text
26841242 We identified a previously unknown missense substitution in ADGRE2 which was predicted to result in the replacement of cysteine with tyrosine as the only nonsynonymous variant cosegregating with vibratory urticaria in two large kindreds.
26153037 Data suggest that blood neutrophils expressing CD11c antigen and EMR2 protein be considered as potential biomarkers for sepsis and systemic inflammatory response syndrome (SIRS), respectively.
22310662 Using the myeloid cell-restricted EMR2 receptor as a paradigm, we exam the mechanistic relevance of the subunit interaction and demonstrate a critical role for autoproteolysis in mediating receptor signaling and cell activation
22035891 a functional role for EMR2 in the modulation of neutrophil activation during inflammation.
21503828 High EMR2 is associated with invasive phenotype in glioblastoma.
21174063 The association of improved patient survival with higher nuclear expression levels identifies EMR2 as a potential biomarker in patients with invasive breast cancer.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20167235 complex cellular expression programmes rather than activation modes regulate the expression of EGF-TM7 receptors in macrophages
18267122 EGF-TM7 pre-mRNAs also undergo the rare trans-splicing, leading to the generation of functional chimeric receptors.
17928360 Here we demonstrate how the human-restricted adhesion-GPCR EMR2 regulates neutrophil responses by potentiating the effects of a number of proinflammatory mediators and show that the transmembrane region is critical for adhesion-GPCR function.
More...

AA Sequence

MGGRVFLVFLAFCVWLTLPGAETQDSRGCARWCPQDSSCVNATACRCNPGFSSFSEIITTPMETCDDINE      1 - 70
CATLSKVSCGKFSDCWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDVDECQQNPRLCKSYGTCVNTL     71 - 140
GSYTCQCLPGFKLKPEDPKLCTDVNECTSGQNPCHSSTHCLNNVGSYQCRCRPGWQPIPGSPNGPNNTVC    141 - 210
EDVDECSSGQHQCDSSTVCFNTVGSYSCRCRPGWKPRHGIPNNQKDTVCEDMTFSTWTPPPGVHSQTLSR    211 - 280
FFDKVQDLGRDYKPGLANNTIQSILQALDELLEAPGDLETLPRLQQHCVASHLLDGLEDVLRGLSKNLSN    281 - 350
GLLNFSYPAGTELSLEVQKQVDRSVTLRQNQAVMQLDWNQAQKSGDPGPSVVGLVSIPGMGKLLAEAPLV    351 - 420
LEPEKQMLLHETHQGLLQDGSPILLSDVISAFLSNNDTQNLSSPVTFTFSHRSVIPRQKVLCVFWEHGQN    421 - 490
GCGHWATTGCSTIGTRDTSTICRCTHLSSFAVLMAHYDVQEEDPVLTVITYMGLSVSLLCLLLAALTFLL    491 - 560
CKAIQNTSTSLHLQLSLCLFLAHLLFLVAIDQTGHKVLCSIIAGTLHYLYLATLTWMLLEALYLFLTARN    561 - 630
LTVVNYSSINRFMKKLMFPVGYGVPAVTVAISAASRPHLYGTPSRCWLQPEKGFIWGFLGPVCAIFSVNL    631 - 700
VLFLVTLWILKNRLSSLNSEVSTLRNTRMLAFKATAQLFILGCTWCLGILQVGPAARVMAYLFTIINSLQ    701 - 770
GVFIFLVYCLLSQQVREQYGKWSKGIRKLKTESEMHTLSSSAKADTSKPSTVN                     771 - 823
//

Text Mined References (34)

PMID Year Title
26841242 2016 Vibratory Urticaria Associated with a Missense Variant in ADGRE2.
26153037 2015 Expression of CD11c and EMR2 on neutrophils: potential diagnostic biomarkers for sepsis and systemic inflammation.
25713288 2015 International Union of Basic and Clinical Pharmacology. XCIV. Adhesion G protein-coupled receptors.
22575658 2012 Signaling property study of adhesion G-protein-coupled receptors.
22310662 2012 Activation of myeloid cell-specific adhesion class G protein-coupled receptor EMR2 via ligation-induced translocation and interaction of receptor subunits in lipid raft microdomains.
22035891 EMR2 receptor ligation modulates cytokine secretion profiles and cell survival of lipopolysaccharide-treated neutrophils.
21503828 2011 Epidermal growth factor module-containing mucin-like receptor 2 is a newly identified adhesion G protein-coupled receptor associated with poor overall survival and an invasive phenotype in glioblastoma.
21174063 2011 Leukocyte adhesion-GPCR EMR2 is aberrantly expressed in human breast carcinomas and is associated with patient survival.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20167235 2010 Differential expression of the EGF-TM7 family members CD97 and EMR2 in lipid-laden macrophages in atherosclerosis, multiple sclerosis and Gaucher disease.
More...