Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.81
PubTator Score 2.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
malignant mesothelioma 3232 4.9e-06
lung cancer 4740 3.7e-03

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer 1.100 3.7e-03
malignant mesothelioma 1.100 4.9e-06

Gene RIF (5)

AA Sequence

MPRYAQLVMGPAGSGKSTYCATMVQHCEALNRSVQVVNLDPAAEHFNYSVMADIRELIEVDDVMEDDSLR      1 - 70
FGPNGGLVFCMEYFANNFDWLENCLGHVEDDYILFDCPGQIELYTHLPVMKQLVQQLEQWEFRVCGVFLV     71 - 140
DSQFMVESFKFISGILAALSAMISLEIPQVNIMTKMDLLSKKAKKEIEKFLDPDMYSLLEDSTSDLRSKK    141 - 210
FKKLTKAICGLIDDYSMVRFLPYDQSDEESMNIVLQHIDFAIQYGEDLEFKEPKEREDESSSMFDEYFQE    211 - 280
CQDE                                                                      281 - 284
//

Text Mined References (21)

PMID Year Title