Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.95
PubTator Score 2.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
lung cancer 4,466
malignant mesothelioma 3,162

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
lung cancer 1.100 0.004

Gene RIF (3)

PMID Text
25241168 Gpn1-Gpn3 interaction was essential to maintain steady-state protein levels of both GTPases
21782856 Parcs/Gpn3 plays a critical role in the nuclear accumulation of RNAP II, and this function explains the relative importance of Parcs/Gpn3 in cell proliferation.
21768307 Data show that GPN1/GPN3 define a new family of small GTPases that are specialized for the transport of RNA polymerase II into the nucleus.

AA Sequence

MPRYAQLVMGPAGSGKSTYCATMVQHCEALNRSVQVVNLDPAAEHFNYSVMADIRELIEVDDVMEDDSLR      1 - 70
FGPNGGLVFCMEYFANNFDWLENCLGHVEDDYILFDCPGQIELYTHLPVMKQLVQQLEQWEFRVCGVFLV     71 - 140
DSQFMVESFKFISGILAALSAMISLEIPQVNIMTKMDLLSKKAKKEIEKFLDPDMYSLLEDSTSDLRSKK    141 - 210
FKKLTKAICGLIDDYSMVRFLPYDQSDEESMNIVLQHIDFAIQYGEDLEFKEPKEREDESSSMFDEYFQE    211 - 280
CQDE                                                                      281 - 284
//

Text Mined References (19)

PMID Year Title
25241168 2014 Gpn1 and Gpn3 associate tightly and their protein levels are mutually dependent in mammalian cells.
21782856 2011 Parcs/Gpn3 is required for the nuclear accumulation of RNA polymerase II.
21768307 2011 Human GTPases associate with RNA polymerase II to mediate its nuclear import.
21269460 2011 Initial characterization of the human central proteome.
20864038 2010 HSP90 and its R2TP/Prefoldin-like cochaperone are involved in the cytoplasmic assembly of RNA polymerase II.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16541075 2006 The finished DNA sequence of human chromosome 12.
16533400 2006 NovelFam3000--uncharacterized human protein domains conserved across model organisms.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
More...