Property Summary

NCBI Gene PubMed Count 19
PubMed Score 5.31
PubTator Score 4.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.267 0.003
astrocytoma -1.500 0.003
ependymoma -1.300 0.046
primary pancreatic ductal adenocarcinoma 1.040 0.007
intraductal papillary-mucinous adenoma (... 1.100 0.002
lung cancer 1.400 0.000
ovarian cancer 2.200 0.000
Breast cancer 1.500 0.000

Synonym

Accession Q9UHV9 Q9P0P7 Q9UN05
Symbols PFD2

Gene

PANTHER Protein Class (1)

Gene RIF (3)

PMID Text
23914742 prefoldin is amplified at 1q23.3-q24.1 in bladder cancer
23720755 knockdown of PFD2 and PFD5 disrupted prefoldin formation in HTT-expressing cells, resulting in accumulation of aggregates of a pathogenic form of HTT and in induction of cell death.
19450687 Is part of an RNA polymerase II-associated complex with possible chaperone activity.

AA Sequence

MAENSGRAGKSSGSGAGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKC      1 - 70
YRMVGGVLVERTVKEVLPALENNKEQIQKIIETLTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSE     71 - 140
GAGAKASSAGVLVS                                                            141 - 154
//

Text Mined References (20)

PMID Year Title
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
23914742 2013 Identification of prefoldin amplification (1q23.3-q24.1) in bladder cancer using comparative genomic hybridization (CGH) arrays of urinary DNA.
23720755 2013 Prefoldin protects neuronal cells from polyglutamine toxicity by preventing aggregation formation.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
19450687 2009 High-resolution mapping of the protein interaction network for the human transcription machinery and affinity purification of RNA polymerase II-associated complexes.
17936702 2007 S6K1-mediated disassembly of mitochondrial URI/PP1gamma complexes activates a negative feedback program that counters S6K1 survival signaling.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16876117 2006 Interaction of hepatitis C virus F protein with prefoldin 2 perturbs tubulin cytoskeleton organization.
15923622 2005 The HRPT2 tumor suppressor gene product parafibromin associates with human PAF1 and RNA polymerase II.
More...