Property Summary

NCBI Gene PubMed Count 40
PubMed Score 90.31
PubTator Score 78.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Pre-Eclampsia 68 6.075 3.0
Patau syndrome 14 3.166 1.6

Gene RIF (29)

AA Sequence

MSSLPVPYKLPVSLSVGSCVIIKGTPIHSFINDPQLQVDFYTDMDEDSDIAFRFRVHFGNHVVMNRREFG      1 - 70
IWMLEETTDYVPFEDGKQFELCIYVHYNEYEIKVNGIRIYGFVHRIPPSFVKMVQVSRDISLTSVCVCN      71 - 139
//

Text Mined References (40)

PMID Year Title