Property Summary

NCBI Gene PubMed Count 28
PubMed Score 21.43
PubTator Score 10.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
Pick disease 1893 2.35730244218961E-7
atypical teratoid / rhabdoid tumor 4369 5.35976662364422E-7
osteosarcoma 7933 1.78629037290576E-6
tuberculosis 1563 5.18211362862706E-6
medulloblastoma, large-cell 6234 1.36484522020248E-5
ovarian cancer 8492 1.77677724000128E-5
lung cancer 4473 3.74389368311752E-5
group 4 medulloblastoma 1875 2.85256023054012E-4
glioblastoma 5572 8.37008027294814E-4
ulcerative colitis 2087 0.00860397314699466
Waldenstrons macroglobulinemia 765 0.0089495604529964
Rheumatoid Arthritis 1171 0.0158087476750804
spina bifida 1064 0.0294440173606223
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (13)

Disease log2 FC p
Rheumatoid Arthritis 1.500 0.016
Waldenstrons macroglobulinemia 1.222 0.009
osteosarcoma 1.874 0.000
atypical teratoid / rhabdoid tumor 1.200 0.000
glioblastoma 1.100 0.001
group 4 medulloblastoma 1.300 0.000
medulloblastoma, large-cell 1.400 0.000
ulcerative colitis -1.106 0.009
tuberculosis -1.100 0.000
lung cancer 2.000 0.000
spina bifida -1.239 0.029
Pick disease 1.300 0.000
ovarian cancer -1.500 0.000

Synonym

Accession Q9UHV7 B2RU05 O60334
Symbols ARC250
THRAP1
DRIP250
HSPC221
TRAP240

Gene

  Ortholog (12)

Gene RIF (5)

PMID Text
26182352 Data suggest that MED13, MED12, CDK8 and cyclin C (CycC) comprise a four-subunit "kinase" module of the Mediator complex that functions as a major ingress of oncogenic and developmental signaling/gene expression in humans. [REVIEW]
25422356 Cardiac overexpression of MED13 in transgenic mice confers a lean phenotype that is associated with increased lipid uptake, beta-oxidation and mitochondrial content in white adipose tissue and liver
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19730683 Observational study of gene-disease association. (HuGE Navigator)
19240132 Med12 and Med13 are critical for human CDK8 subcomplex -dependent repression, whereas CDK8 kinase activity is not

AA Sequence

MSASFVPNGASLEDCHCNLFCLADLTGIKWKKYVWQGPTSAPILFPVTEEDPILSSFSRCLKADVLGVWR      1 - 70
RDQRPGRRELWIFWWGEDPSFADLIHHDLSEEEDGVWENGLSYECRTLLFKAVHNLLERCLMNRNFVRIG     71 - 140
KWFVKPYEKDEKPINKSEHLSCSFTFFLHGDSNVCTSVEINQHQPVYLLSEEHITLAQQSNSPFQVILCP    141 - 210
FGLNGTLTGQAFKMSDSATKKLIGEWKQFYPISCCLKEMSEEKQEDMDWEDDSLAAVEVLVAGVRMIYPA    211 - 280
CFVLVPQSDIPTPSPVGSTHCSSSCLGVHQVPASTRDPAMSSVTLTPPTSPEEVQTVDPQSVQKWVKFSS    281 - 350
VSDGFNSDSTSHHGGKIPRKLANHVVDRVWQECNMNRAQNKRKYSASSGGLCEEATAAKVASWDFVEATQ    351 - 420
RTNCSCLRHKNLKSRNAGQQGQAPSLGQQQQILPKHKTNEKQEKSEKPQKRPLTPFHHRVSVSDDVGMDA    421 - 490
DSASQRLVISAPDSQVRFSNIRTNDVAKTPQMHGTEMANSPQPPPLSPHPCDVVDEGVTKTPSTPQSQHF    491 - 560
YQMPTPDPLVPSKPMEDRIDSLSQSFPPQYQEAVEPTVYVGTAVNLEEDEANIAWKYYKFPKKKDVEFLP    561 - 630
PQLPSDKFKDDPVGPFGQESVTSVTELMVQCKKPLKVSDELVQQYQIKNQCLSAIASDAEQEPKIDPYAF    631 - 700
VEGDEEFLFPDKKDRQNSEREAGKKHKVEDGTSSVTVLSHEEDAMSLFSPSIKQDAPRPTSHARPPSTSL    701 - 770
IYDSDLAVSYTDLDNLFNSDEDELTPGSKKSANGSDDKASCKESKTGNLDPLSCISTADLHKMYPTPPSL    771 - 840
EQHIMGFSPMNMNNKEYGSMDTTPGGTVLEGNSSSIGAQFKIEVDEGFCSPKPSEIKDFSYVYKPENCQI    841 - 910
LVGCSMFAPLKTLPSQYLPPIKLPEECIYRQSWTVGKLELLSSGPSMPFIKEGDGSNMDQEYGTAYTPQT    911 - 980
HTSFGMPPSSAPPSNSGAGILPSPSTPRFPTPRTPRTPRTPRGAGGPASAQGSVKYENSDLYSPASTPST    981 - 1050
CRPLNSVEPATVPSIPEAHSLYVNLILSESVMNLFKDCNFDSCCICVCNMNIKGADVGVYIPDPTQEAQY   1051 - 1120
RCTCGFSAVMNRKFGNNSGLFLEDELDIIGRNTDCGKEAEKRFEALRATSAEHVNGGLKESEKLSDDLIL   1121 - 1190
LLQDQCTNLFSPFGAADQDPFPKSGVISNWVRVEERDCCNDCYLALEHGRQFMDNMSGGKVDEALVKSSC   1191 - 1260
LHPWSKRNDVSMQCSQDILRMLLSLQPVLQDAIQKKRTVRPWGVQGPLTWQQFHKMAGRGSYGTDESPEP   1261 - 1330
LPIPTFLLGYDYDYLVLSPFALPYWERLMLEPYGSQRDIAYVVLCPENEALLNGAKSFFRDLTAIYESCR   1331 - 1400
LGQHRPVSRLLTDGIMRVGSTASKKLSEKLVAEWFSQAADGNNEAFSKLKLYAQVCRYDLGPYLASLPLD   1401 - 1470
SSLLSQPNLVAPTSQSLITPPQMTNTGNANTPSATLASAASSTMTVTSGVAISTSVATANSTLTTASTSS   1471 - 1540
SSSSNLNSGVSSNKLPSFPPFGSMNSNAAGSMSTQANTVQSGQLGGQQTSALQTAGISGESSSLPTQPHP   1541 - 1610
DVSESTMDRDKVGIPTDGDSHAVTYPPAIVVYIIDPFTYENTDESTNSSSVWTLGLLRCFLEMVQTLPPH   1611 - 1680
IKSTVSVQIIPCQYLLQPVKHEDREIYPQHLKSLAFSAFTQCRRPLPTSTNVKTLTGFGPGLAMETALRS   1681 - 1750
PDRPECIRLYAPPFILAPVKDKQTELGETFGEAGQKYNVLFVGYCLSHDQRWILASCTDLYGELLETCII   1751 - 1820
NIDVPNRARRKKSSARKFGLQKLWEWCLGLVQMSSLPWRVVIGRLGRIGHGELKDWSCLLSRRNLQSLSK   1821 - 1890
RLKDMCRMCGISAADSPSILSACLVAMEPQGSFVIMPDSVSTGSVFGRSTTLNMQTSQLNTPQDTSCTHI   1891 - 1960
LVFPTSASVQVASATYTTENLDLAFNPNNDGADGMGIFDLLDTGDDLDPDIINILPASPTGSPVHSPGSH   1961 - 2030
YPHGGDAGKGQSTDRLLSTEPHEEVPNILQQPLALGYFVSTAKAGPLPDWFWSACPQAQYQCPLFLKASL   2031 - 2100
HLHVPSVQSDELLHSKHSHPLDSNQTSDVLRFVLEQYNALSWLTCDPATQDRRSCLPIHFVVLNQLYNFI   2101 - 2170
MNML                                                                     2171 - 2174
//

Text Mined References (38)

PMID Year Title
26182352 2015 Mediator kinase module and human tumorigenesis.
25422356 2014 MED13-dependent signaling from the heart confers leanness by enhancing metabolism in adipose tissue and liver.
24850809 2014 Genetic determinants of P wave duration and PR segment.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19946888 2010 Defining the membrane proteome of NK cells.
19730683 2009 The variant rs1867277 in FOXE1 gene confers thyroid cancer susceptibility through the recruitment of USF1/USF2 transcription factors.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19369195 2009 Large-scale proteomics analysis of the human kinome.
More...