Property Summary

NCBI Gene PubMed Count 26
PubMed Score 20.89
PubTator Score 17.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (8)

Disease log2 FC p
group 3 medulloblastoma -1.300 1.2e-02
invasive ductal carcinoma -1.192 1.4e-02
medulloblastoma, large-cell -1.200 4.3e-03
non-small cell lung cancer -1.677 2.2e-18
ovarian cancer 1.200 6.2e-04
pancreatic cancer 1.900 7.6e-04
primary pancreatic ductal adenocarcinoma 1.774 4.3e-04
tuberculosis -1.100 8.6e-03

Synonym

Accession Q9UHV2 Q9BUE7
Symbols SEI1
TRIP-Br1

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (14)

AA Sequence

MLSKGLKRKREEEEEKEPLAVDSWWLDPGHTAVAQAPPAVASSSLFDLSVLKLHHSLQQSEPDLRHLVLV      1 - 70
VNTLRRIQASMAPAAALPPVPSPPAAPSVADNLLASSDAALSASMASLLEDLSHIEGLSQAPQPLADEGP     71 - 140
PGRSIGGAAPSLGALDLLGPATGCLLDDGLEGLFEDIDTSMYDNELWAPASEGLKPGPEDGPGKEEAPEL    141 - 210
DEAELDYLMDVLVGTQALERPPGPGR                                                211 - 236
//

Text Mined References (27)

PMID Year Title