Property Summary

NCBI Gene PubMed Count 22
Grant Count 10
R01 Count 9
Funding $565,843.28
PubMed Score 19.64
PubTator Score 17.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
group 3 medulloblastoma -1.300 0.012
medulloblastoma, large-cell -1.200 0.004
primary pancreatic ductal adenocarcinoma 1.774 0.000
tuberculosis -1.100 0.009
non-small cell lung cancer -1.677 0.000
invasive ductal carcinoma -1.192 0.014
ovarian cancer 1.200 0.001
pancreatic cancer 1.900 0.001

Gene RIF (11)

PMID Text
26334958 TRIP-Br1 confers resistance to serum starvation-induced cell deaths by stabilizing the XIAP protein and inhibiting cellular ROS production.
24789658 Data demonstrate that p34SEI-1 induces the activation of either AKT or ILK signaling on HER2/neu expression status.
23970032 High SERTAD1 expression is associated with breast cancer.
21725208 These results suggest that p34 (SEI-1) inhibits ROS-induced cell death through by indirectly inducing ubiquitination of ASK1.
21344158 study shows that the p34SE1-1 expression level was not changed after H2O2 treatment at either protein or transcriptional levels
21044367 Observational study of gene-disease association. (HuGE Navigator)
20570897 Translocation of small amount of NM23H1 into the nucleus induced by the overexpressions of SEI1/SET could increase the frequency of sister chromatid exchangein esophageal cancers.
16201750 p34(SEI-1) and p16(INK4A) have different roles in development of squamous cell carcinoma of the head and neck
15065884 p34SEI1 fragment 30-160 can bind, activate, and inhibit cyclin-dependent kinase CDK4; fragment 30-132 binds and activates but does not inhibit CDK4, while fragment 30-88 cannot bind, activate, or inhibit but retains LexA-mediated transactivation activity.
14675634 interacts with low- and high-risk HPV11 and HPV16 E6 proteins in yeast, in vitro and in mammalian cell cultures
More...

AA Sequence

MLSKGLKRKREEEEEKEPLAVDSWWLDPGHTAVAQAPPAVASSSLFDLSVLKLHHSLQQSEPDLRHLVLV      1 - 70
VNTLRRIQASMAPAAALPPVPSPPAAPSVADNLLASSDAALSASMASLLEDLSHIEGLSQAPQPLADEGP     71 - 140
PGRSIGGAAPSLGALDLLGPATGCLLDDGLEGLFEDIDTSMYDNELWAPASEGLKPGPEDGPGKEEAPEL    141 - 210
DEAELDYLMDVLVGTQALERPPGPGR                                                211 - 236
//

Text Mined References (23)

PMID Year Title
26334958 2015 TRIP-Br1 oncoprotein inhibits autophagy, apoptosis, and necroptosis under nutrient/serum-deprived condition.
24789658 2014 Distinct regulatory effect of the p34SEI-1 oncoprotein on cancer metastasis in HER2/neu-positive and -negative cells.
23970032 2013 Oncogenic function of p34SEI-1 via NEDD4?1?mediated PTEN ubiquitination/degradation and activation of the PI3K/AKT pathway.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21725208 2011 p34 (SEI-1) inhibits ROS-induced cell death through suppression of ASK1.
21344158 2011 Effect of PP2A on p34SEI-1 expression in response to ionizing radiation in MCF-7 human breast cancer cells.
21044367 2010 An integrative method for scoring candidate genes from association studies: application to warfarin dosing.
20570897 2010 Characterization of a novel mechanism of genomic instability involving the SEI1/SET/NM23H1 pathway in esophageal cancers.
18316374 2008 CRM1-mediated nuclear export is required for 26 S proteasome-dependent degradation of the TRIP-Br2 proto-oncoprotein.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
More...