Property Summary

NCBI Gene PubMed Count 22
PubMed Score 19.64
PubTator Score 17.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Colonic Neoplasms 126
Disease Target Count P-value
non-small cell lung cancer 2798 2.17178923245265E-18
primary pancreatic ductal adenocarcinoma 1271 4.30173446548984E-4
ovarian cancer 8492 6.22072394068878E-4
pancreatic cancer 2300 7.56859354447261E-4
medulloblastoma, large-cell 6234 0.00427798978564477
tuberculosis 1563 0.00860324568655283
group 3 medulloblastoma 2254 0.0121345890064121
invasive ductal carcinoma 2950 0.0137482207013345

Expression

  Differential Expression (8)

Disease log2 FC p
group 3 medulloblastoma -1.300 0.012
medulloblastoma, large-cell -1.200 0.004
primary pancreatic ductal adenocarcinoma 1.774 0.000
tuberculosis -1.100 0.009
non-small cell lung cancer -1.677 0.000
invasive ductal carcinoma -1.192 0.014
ovarian cancer 1.200 0.001
pancreatic cancer 1.900 0.001

Synonym

Accession Q9UHV2 Q9BUE7
Symbols SEI1
TRIP-Br1

Gene

PANTHER Protein Class (1)

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid

Gene RIF (11)

PMID Text
26334958 TRIP-Br1 confers resistance to serum starvation-induced cell deaths by stabilizing the XIAP protein and inhibiting cellular ROS production.
24789658 Data demonstrate that p34SEI-1 induces the activation of either AKT or ILK signaling on HER2/neu expression status.
23970032 High SERTAD1 expression is associated with breast cancer.
21725208 These results suggest that p34 (SEI-1) inhibits ROS-induced cell death through by indirectly inducing ubiquitination of ASK1.
21344158 study shows that the p34SE1-1 expression level was not changed after H2O2 treatment at either protein or transcriptional levels
21044367 Observational study of gene-disease association. (HuGE Navigator)
20570897 Translocation of small amount of NM23H1 into the nucleus induced by the overexpressions of SEI1/SET could increase the frequency of sister chromatid exchangein esophageal cancers.
16201750 p34(SEI-1) and p16(INK4A) have different roles in development of squamous cell carcinoma of the head and neck
15065884 p34SEI1 fragment 30-160 can bind, activate, and inhibit cyclin-dependent kinase CDK4; fragment 30-132 binds and activates but does not inhibit CDK4, while fragment 30-88 cannot bind, activate, or inhibit but retains LexA-mediated transactivation activity.
14675634 interacts with low- and high-risk HPV11 and HPV16 E6 proteins in yeast, in vitro and in mammalian cell cultures
More...

AA Sequence

MLSKGLKRKREEEEEKEPLAVDSWWLDPGHTAVAQAPPAVASSSLFDLSVLKLHHSLQQSEPDLRHLVLV      1 - 70
VNTLRRIQASMAPAAALPPVPSPPAAPSVADNLLASSDAALSASMASLLEDLSHIEGLSQAPQPLADEGP     71 - 140
PGRSIGGAAPSLGALDLLGPATGCLLDDGLEGLFEDIDTSMYDNELWAPASEGLKPGPEDGPGKEEAPEL    141 - 210
DEAELDYLMDVLVGTQALERPPGPGR                                                211 - 236
//

Text Mined References (23)

PMID Year Title
26334958 2015 TRIP-Br1 oncoprotein inhibits autophagy, apoptosis, and necroptosis under nutrient/serum-deprived condition.
24789658 2014 Distinct regulatory effect of the p34SEI-1 oncoprotein on cancer metastasis in HER2/neu-positive and -negative cells.
23970032 2013 Oncogenic function of p34SEI-1 via NEDD4?1?mediated PTEN ubiquitination/degradation and activation of the PI3K/AKT pathway.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21725208 2011 p34 (SEI-1) inhibits ROS-induced cell death through suppression of ASK1.
21344158 2011 Effect of PP2A on p34SEI-1 expression in response to ionizing radiation in MCF-7 human breast cancer cells.
21044367 2010 An integrative method for scoring candidate genes from association studies: application to warfarin dosing.
20570897 2010 Characterization of a novel mechanism of genomic instability involving the SEI1/SET/NM23H1 pathway in esophageal cancers.
18316374 2008 CRM1-mediated nuclear export is required for 26 S proteasome-dependent degradation of the TRIP-Br2 proto-oncoprotein.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
More...