Knowledge Summary

Patent

No data available

Synonym

Accession Q9UHU1
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MLTALGQVNNIQKEFTIKKTKQADHNLVARIDEIQYVQGTINL                                 1 - 43
//