Property Summary

NCBI Gene PubMed Count 31
PubMed Score 13.89
PubTator Score 12.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
non-small cell lung cancer 2798 4.13807761721441E-26
osteosarcoma 7933 3.1365351620774E-13
lung adenocarcinoma 2714 4.60148933144067E-9
pancreatic cancer 2300 3.53962504552277E-6
pituitary cancer 1972 1.59662001085326E-5
ovarian cancer 8492 2.38055841669538E-5
atypical teratoid / rhabdoid tumor 4369 2.50375062882709E-5
ulcerative colitis 2087 2.99741919762208E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 5.02250045956635E-4
interstitial cystitis 2299 5.05014444348617E-4
medulloblastoma 1524 8.41809218428723E-4
medulloblastoma, large-cell 6234 0.0059426460759746
ductal carcinoma in situ 1745 0.00656287406121227
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0101358783452493
invasive ductal carcinoma 2950 0.0228333759744011
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0353766756755639
spina bifida 1064 0.0368869036225827
glioblastoma 5572 0.0404768095586078
Disease Target Count Z-score Confidence
Prostate cancer 172 0.0 1.0
Disease Target Count Z-score Confidence
dentatorubral-pallidoluysian atrophy 21 4.393 2.2

Expression

Gene

PANTHER Protein Class (1)

PDB

2KXC   2LNH  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (9)

PMID Text
26222696 Upregulation of BAIAP2L1 is associated with ovarian cancer.
25589496 Lacking the Bin-Amphiphysin-Rvs (BAR) dimerization domain of BAIAP2L1.
23693078 IRTKS can interact with epidermal growth factor receptor (EGFR), results in the phosphorylation of extracellular signal-regulated kinase
23175443 Identification of a novel oncogenic FGFR3-BAIAP2L1 fusion protein in bladder cancer.
21887275 These data suggest that IRTKS is a novel regulator of p53, modulating low level of MDM2-mediated p53 ubiquitination in unstressed cells.
21840312 data suggest Src-stimulated IRTKS phosphorylation is essential for its function in cell motility
21098279 Results describe the NMR structure of insulin receptor tyrosine kinase substrate (IRTKS) SH3 domain in complex with a repeat from Escherichia coli-secreted protein F-like protein encoded on prophage U (EspF(U)).
19366662 Screening of the mammalian SH3 proteome for the ability to bind EspF(U) identified the SH3 domain of insulin receptor tyrosine kinase substrate (IRTKS), a factor known to regulate the cytoskeleton.
17430976 Study characterised IRTKS, which has widespread tissue distribution, is a substrate for the insulin receptor and binds Rac, and expression of IRTKS induces clusters of short actin bundles rather than filopodia-like protrusions.

AA Sequence

MSRGPEEVNRLTESTYRNVMEQFNPGLRNLINLGKNYEKAVNAMILAGKAYYDGVAKIGEIATGSPVSTE      1 - 70
LGHVLIEISSTHKKLNESLDENFKKFHKEIIHELEKKIELDVKYMNATLKRYQTEHKNKLESLEKSQAEL     71 - 140
KKIRRKSQGSRNALKYEHKEIEYVETVTSRQSEIQKFIADGCKEALLEEKRRFCFLVDKHCGFANHIHYY    141 - 210
HLQSAELLNSKLPRWQETCVDAIKVPEKIMNMIEEIKTPASTPVSGTPQASPMIERSNVVRKDYDTLSKC    211 - 280
SPKMPPAPSGRAYTSPLIDMFNNPATAAPNSQRVNNSTGTSEDPSLQRSVSVATGLNMMKKQKVKTIFPH    281 - 350
TAGSNKTLLSFAQGDVITLLIPEEKDGWLYGEHDVSKARGWFPSSYTKLLEENETEAVTVPTPSPTPVRS    351 - 420
ISTVNLSENSSVVIPPPDYLECLSMGAAADRRADSARTTSTFKAPASKPETAAPNDANGTAKPPFLSGEN    421 - 490
PFATVKLRPTVTNDRSAPIIR                                                     491 - 511
//

Text Mined References (40)

PMID Year Title
26222696 2015 BAI1-Associated Protein 2-Like 1 (BAIAP2L1) Is a Potential Biomarker in Ovarian Cancer.
25589496 2015 Mechanism of Oncogenic Signal Activation by the Novel Fusion Kinase FGFR3-BAIAP2L1.
25519916 2014 The EHEC-host interactome reveals novel targets for the translocated intimin receptor.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23693078 2013 Insulin receptor tyrosine kinase substrate activates EGFR/ERK signalling pathway and promotes cell proliferation of hepatocellular carcinoma.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23175443 2013 Oncogenic FGFR3 gene fusions in bladder cancer.
More...