Property Summary

NCBI Gene PubMed Count 34
PubMed Score 14.37
PubTator Score 12.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 1.8e-03
ductal carcinoma in situ 1.100 1.4e-03
glioblastoma 1.100 4.0e-02
group 3 medulloblastoma 1.200 1.6e-02
interstitial cystitis -1.400 1.0e-02
intraductal papillary-mucinous carcinoma... 1.100 1.0e-02
intraductal papillary-mucinous neoplasm ... 1.400 5.0e-04
invasive ductal carcinoma 1.700 6.1e-03
lung adenocarcinoma 1.200 4.6e-09
medulloblastoma, large-cell 1.900 5.9e-03
non-small cell lung cancer 1.897 2.3e-22
osteosarcoma -4.547 3.1e-13
ovarian cancer 3.100 2.4e-05
pancreatic cancer 1.500 3.5e-06
pancreatic ductal adenocarcinoma liver m... 1.275 2.3e-02
pituitary cancer -1.200 1.6e-05
spina bifida -2.035 4.3e-02
ulcerative colitis 1.100 2.1e-04

Gene RIF (11)

AA Sequence

MSRGPEEVNRLTESTYRNVMEQFNPGLRNLINLGKNYEKAVNAMILAGKAYYDGVAKIGEIATGSPVSTE      1 - 70
LGHVLIEISSTHKKLNESLDENFKKFHKEIIHELEKKIELDVKYMNATLKRYQTEHKNKLESLEKSQAEL     71 - 140
KKIRRKSQGSRNALKYEHKEIEYVETVTSRQSEIQKFIADGCKEALLEEKRRFCFLVDKHCGFANHIHYY    141 - 210
HLQSAELLNSKLPRWQETCVDAIKVPEKIMNMIEEIKTPASTPVSGTPQASPMIERSNVVRKDYDTLSKC    211 - 280
SPKMPPAPSGRAYTSPLIDMFNNPATAAPNSQRVNNSTGTSEDPSLQRSVSVATGLNMMKKQKVKTIFPH    281 - 350
TAGSNKTLLSFAQGDVITLLIPEEKDGWLYGEHDVSKARGWFPSSYTKLLEENETEAVTVPTPSPTPVRS    351 - 420
ISTVNLSENSSVVIPPPDYLECLSMGAAADRRADSARTTSTFKAPASKPETAAPNDANGTAKPPFLSGEN    421 - 490
PFATVKLRPTVTNDRSAPIIR                                                     491 - 511
//

Text Mined References (42)

PMID Year Title