Property Summary

NCBI Gene PubMed Count 16
PubMed Score 7.13
PubTator Score 0.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
interstitial cystitis 2299 6.18263001578072E-5
medulloblastoma, large-cell 6234 1.77711058354846E-4
osteosarcoma 7933 0.00748055108119787
Multiple myeloma 1328 0.0132434162695129
gastric carcinoma 832 0.0134384535589328
glioblastoma 5572 0.0170990489055134
esophageal adenocarcinoma 737 0.0179350527878244
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0224210260634003
subependymal giant cell astrocytoma 2287 0.0298650960308526
astrocytoma 1493 0.0388153812133501
Disease Target Count Z-score Confidence
Methemoglobinemia 17 5.648 2.8

Expression

  Differential Expression (10)

Disease log2 FC p
Multiple myeloma 1.036 0.013
esophageal adenocarcinoma -1.100 0.018
osteosarcoma -1.032 0.007
astrocytoma 1.200 0.039
glioblastoma 1.200 0.017
medulloblastoma, large-cell -1.200 0.000
pancreatic ductal adenocarcinoma liver m... -1.016 0.022
interstitial cystitis -1.400 0.000
subependymal giant cell astrocytoma 1.640 0.030
gastric carcinoma -1.700 0.013

Synonym

Accession Q9UHQ9 A0PK21 B2R8E0 O95329 Q53F73 Q8NCL5 Q9UHJ1 b5R.1
Symbols B5R1
B5R2
B5R.1
NQO3A2
humb5R2

Gene

PANTHER Protein Class (2)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG
C. elegans OMA EggNOG
S.cerevisiae OMA EggNOG

Gene RIF (4)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGIQTSPVLLASLGVGLVTLLGLAVGSYLVRRSRRPQVTLLDPNEKYLLRLLDKTTVSHNTKRFRFALPT      1 - 70
AHHTLGLPVGKHIYLSTRIDGSLVIRPYTPVTSDEDQGYVDLVIKVYLKGVHPKFPEGGKMSQYLDSLKV     71 - 140
GDVVEFRGPSGLLTYTGKGHFNIQPNKKSPPEPRVAKKLGMIAGGTGITPMLQLIRAILKVPEDPTQCFL    141 - 210
LFANQTEKDIILREDLEELQARYPNRFKLWFTLDHPPKDWAYSKGFVTADMIREHLPAPGDDVLVLLCGP    211 - 280
PPMVQLACHPNLDKLGYSQKMRFTY                                                 281 - 305
//

Text Mined References (21)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20833797 2011 Phosphoproteome analysis of functional mitochondria isolated from resting human muscle reveals extensive phosphorylation of inner membrane protein complexes and enzymes.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
More...