Property Summary

NCBI Gene PubMed Count 17
PubMed Score 7.22
PubTator Score 0.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytoma 1.200 3.9e-02
esophageal adenocarcinoma -1.100 1.8e-02
gastric carcinoma -1.700 1.3e-02
glioblastoma 1.200 1.7e-02
interstitial cystitis -1.300 8.9e-04
medulloblastoma, large-cell -1.200 1.8e-04
Multiple myeloma 1.036 1.3e-02
osteosarcoma -1.032 7.5e-03
pancreatic ductal adenocarcinoma liver m... -1.016 2.2e-02
subependymal giant cell astrocytoma 1.640 3.0e-02

Gene RIF (5)

AA Sequence

MGIQTSPVLLASLGVGLVTLLGLAVGSYLVRRSRRPQVTLLDPNEKYLLRLLDKTTVSHNTKRFRFALPT      1 - 70
AHHTLGLPVGKHIYLSTRIDGSLVIRPYTPVTSDEDQGYVDLVIKVYLKGVHPKFPEGGKMSQYLDSLKV     71 - 140
GDVVEFRGPSGLLTYTGKGHFNIQPNKKSPPEPRVAKKLGMIAGGTGITPMLQLIRAILKVPEDPTQCFL    141 - 210
LFANQTEKDIILREDLEELQARYPNRFKLWFTLDHPPKDWAYSKGFVTADMIREHLPAPGDDVLVLLCGP    211 - 280
PPMVQLACHPNLDKLGYSQKMRFTY                                                 281 - 305
//

Text Mined References (22)

PMID Year Title