Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.79
PubTator Score 0.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

AA Sequence

MKSCQKMEGKPENESEPKHEEEPKPEEKPEEEEKLEEEAKAKGTFRERLIQSLQEFKEDIHNRHLSNEDM      1 - 70
FREVDEIDEIRRVRNKLIVMRWKVNRNHPYPYLM                                         71 - 104
//

Text Mined References (8)

PMID Year Title
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16221301 2005 Mammalian BEX, WEX and GASP genes: coding and non-coding chimaerism sustained by gene conversion events.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
9171351 1997 FBP WW domains and the Abl SH3 domain bind to a specific class of proline-rich ligands.