Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.79
PubTator Score 0.47

Knowledge Summary


No data available


  Differential Expression (13)

Disease log2 FC p
acute quadriplegic myopathy 1.076 6.0e-05
Astrocytoma, Pilocytic 1.100 2.6e-04
autosomal dominant Emery-Dreifuss muscul... 1.486 8.6e-04
Duchenne muscular dystrophy 1.473 3.2e-07
glioblastoma 1.300 8.5e-03
juvenile dermatomyositis 1.292 1.5e-10
osteosarcoma 4.015 6.0e-09
ovarian cancer -2.000 9.7e-05
pancreatic cancer 1.100 2.1e-03
pancreatic carcinoma 1.100 2.1e-03
pediatric high grade glioma 1.300 6.0e-05
psoriasis 2.800 1.7e-05
tuberculosis -1.300 2.2e-04


Accession Q9UHQ7 B2R5H6 TCEA-like protein 9
Symbols WBP5


PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG

Gene RIF (1)

AA Sequence

FREVDEIDEIRRVRNKLIVMRWKVNRNHPYPYLM                                         71 - 104

Text Mined References (9)

PMID Year Title