Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.79
PubTator Score 0.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
juvenile dermatomyositis 1189 1.47760188209919E-10
osteosarcoma 7933 5.98544787714563E-9
Duchenne muscular dystrophy 602 3.23141571877177E-7
psoriasis 6685 1.69604398498521E-5
pediatric high grade glioma 2712 5.95266312795308E-5
acute quadriplegic myopathy 1157 5.96609113611144E-5
ovarian cancer 8492 9.66422819274417E-5
pilocytic astrocytoma 3086 2.04252260031347E-4
autosomal dominant Emery-Dreifuss muscular dystrophy 499 8.62664464851361E-4
tuberculosis and treatment for 3 months 327 0.00123048275080415
pancreatic cancer 2300 0.00207662291362105
pancreatic carcinoma 567 0.00207662291362108
glioblastoma 5572 0.00846911491779212

Expression

  Differential Expression (13)

AA Sequence

MKSCQKMEGKPENESEPKHEEEPKPEEKPEEEEKLEEEAKAKGTFRERLIQSLQEFKEDIHNRHLSNEDM      1 - 70
FREVDEIDEIRRVRNKLIVMRWKVNRNHPYPYLM                                         71 - 104
//

Text Mined References (8)

PMID Year Title
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16221301 2005 Mammalian BEX, WEX and GASP genes: coding and non-coding chimaerism sustained by gene conversion events.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
9171351 1997 FBP WW domains and the Abl SH3 domain bind to a specific class of proline-rich ligands.