Property Summary

NCBI Gene PubMed Count 19
PubMed Score 5.41
PubTator Score 6.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
ependymoma -1.700 0.016
psoriasis -2.700 0.000
osteosarcoma -1.626 0.000
atypical teratoid / rhabdoid tumor -2.000 0.000
glioblastoma 1.500 0.002
medulloblastoma -1.400 0.000
medulloblastoma, large-cell -2.200 0.000
primitive neuroectodermal tumor -1.300 0.019
pancreatic ductal adenocarcinoma liver m... -1.008 0.014
adult high grade glioma 1.500 0.010
pilocytic astrocytoma -1.100 0.000
Pick disease -1.400 0.000
progressive supranuclear palsy -1.100 0.037
gastric carcinoma -1.500 0.007
ovarian cancer 2.100 0.000

Synonym

Accession Q9UHQ4 G5E9L4 O95003 BCR-associated protein 29
Symbols BAP29

Gene

PANTHER Protein Class (1)

PDB

4W7Y   4W7Z   4W80  

Gene RIF (4)

PMID Text
21068099 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20677014 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
18097552 Bap29varP acts as an essential chaperone, influencing the processing and trafficking of Pgp to the cell surface.

AA Sequence

MTLQWAAVATFLYAEIGLILIFCLPFIPPQRWQKIFSFNVWGKIATFWNKAFLTIIILLIVLFLDAVREV      1 - 70
RKYSSVHTIEKSSTSRPDAYEHTQMKLFRSQRNLYISGFSLFFWLVLRRLVTLITQLAKELSNKGVLKTQ     71 - 140
AENTNKAAKKFMEENEKLKRILKSHGKDEECVLEAENKKLVEDQEKLKTELRKTSDALSKAQNDVMEMKM    141 - 210
QSERLSKEYDQLLKEHSELQDRLERGNKKRL                                           211 - 241
//

Text Mined References (21)

PMID Year Title
25327138 2014 A disulfide polymerized protein crystal.
21378988 2011 A genome-wide association study in Europeans and South Asians identifies five new loci for coronary artery disease.
21269460 2011 Initial characterization of the human central proteome.
21068099 2011 Meta-analysis of genome-wide association studies confirms a susceptibility locus for knee osteoarthritis on chromosome 7q22.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19946888 2010 Defining the membrane proteome of NK cells.
18097552 2008 Bap29varP, a variant of Bap29, influences the cell surface expression of the human P-glycoprotein.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16210410 2005 Differential expression profiling of membrane proteins by quantitative proteomics in a human mesenchymal stem cell line undergoing osteoblast differentiation.
More...