Property Summary

NCBI Gene PubMed Count 19
PubMed Score 5.90
PubTator Score 6.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.200 3.5e-04
Astrocytoma, Pilocytic -1.100 2.9e-05
atypical teratoid / rhabdoid tumor -2.000 7.0e-08
ependymoma -1.700 1.6e-02
gastric carcinoma -1.500 6.9e-03
glioblastoma -1.100 1.7e-03
group 4 medulloblastoma -1.100 2.2e-04
medulloblastoma, large-cell -1.800 5.4e-04
osteosarcoma -1.220 8.0e-03
ovarian cancer 1.400 3.8e-14
pancreatic ductal adenocarcinoma liver m... -1.008 1.4e-02
Pick disease -1.400 1.2e-04
primitive neuroectodermal tumor -1.300 1.9e-02
progressive supranuclear palsy -1.100 3.7e-02
psoriasis -2.700 5.2e-05

Gene RIF (4)

AA Sequence

MTLQWAAVATFLYAEIGLILIFCLPFIPPQRWQKIFSFNVWGKIATFWNKAFLTIIILLIVLFLDAVREV      1 - 70
RKYSSVHTIEKSSTSRPDAYEHTQMKLFRSQRNLYISGFSLFFWLVLRRLVTLITQLAKELSNKGVLKTQ     71 - 140
AENTNKAAKKFMEENEKLKRILKSHGKDEECVLEAENKKLVEDQEKLKTELRKTSDALSKAQNDVMEMKM    141 - 210
QSERLSKEYDQLLKEHSELQDRLERGNKKRL                                           211 - 241
//

Text Mined References (21)

PMID Year Title