Property Summary

NCBI Gene PubMed Count 19
PubMed Score 5.41
PubTator Score 6.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Coronary heart disease 59
Disease Target Count P-value
ovarian cancer 8492 2.77148230888375E-10
atypical teratoid / rhabdoid tumor 4369 6.95786600118599E-8
medulloblastoma, large-cell 6234 2.86434281361063E-7
osteosarcoma 7933 3.48712057843664E-6
medulloblastoma 1524 8.31184718578916E-6
pilocytic astrocytoma 3086 2.54530084355979E-5
psoriasis 6685 5.20122565376808E-5
Pick disease 1893 1.18294194299631E-4
glioblastoma 5572 0.0020703531518161
gastric carcinoma 832 0.00685093012150468
adult high grade glioma 2148 0.00964181547438295
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0141071455455259
ependymoma 2514 0.0159749854628408
primitive neuroectodermal tumor 3031 0.0188656779316023
progressive supranuclear palsy 674 0.0371725972192317
Disease Target Count Z-score Confidence
Cardiovascular system disease 194 0.0 2.0
Disease Target Count Z-score Confidence
Presbyopia 19 4.332 2.2

Expression

  Differential Expression (15)

Disease log2 FC p
ependymoma -1.700 0.016
psoriasis -2.700 0.000
osteosarcoma -1.626 0.000
atypical teratoid / rhabdoid tumor -2.000 0.000
glioblastoma 1.500 0.002
medulloblastoma -1.400 0.000
medulloblastoma, large-cell -2.200 0.000
primitive neuroectodermal tumor -1.300 0.019
pancreatic ductal adenocarcinoma liver m... -1.008 0.014
adult high grade glioma 1.500 0.010
pilocytic astrocytoma -1.100 0.000
Pick disease -1.400 0.000
progressive supranuclear palsy -1.100 0.037
gastric carcinoma -1.500 0.007
ovarian cancer 2.100 0.000

Synonym

Accession Q9UHQ4 G5E9L4 O95003 BCR-associated protein 29
Symbols BAP29

Gene

PANTHER Protein Class (1)

PDB

4W7Y   4W7Z   4W80  

  Ortholog (10)

 GWAS Trait (1)

Pathway (1)

Gene RIF (4)

PMID Text
21068099 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20677014 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
18097552 Bap29varP acts as an essential chaperone, influencing the processing and trafficking of Pgp to the cell surface.

AA Sequence

MTLQWAAVATFLYAEIGLILIFCLPFIPPQRWQKIFSFNVWGKIATFWNKAFLTIIILLIVLFLDAVREV      1 - 70
RKYSSVHTIEKSSTSRPDAYEHTQMKLFRSQRNLYISGFSLFFWLVLRRLVTLITQLAKELSNKGVLKTQ     71 - 140
AENTNKAAKKFMEENEKLKRILKSHGKDEECVLEAENKKLVEDQEKLKTELRKTSDALSKAQNDVMEMKM    141 - 210
QSERLSKEYDQLLKEHSELQDRLERGNKKRL                                           211 - 241
//

Text Mined References (21)

PMID Year Title
25327138 2014 A disulfide polymerized protein crystal.
21378988 2011 A genome-wide association study in Europeans and South Asians identifies five new loci for coronary artery disease.
21269460 2011 Initial characterization of the human central proteome.
21068099 2011 Meta-analysis of genome-wide association studies confirms a susceptibility locus for knee osteoarthritis on chromosome 7q22.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19946888 2010 Defining the membrane proteome of NK cells.
18097552 2008 Bap29varP, a variant of Bap29, influences the cell surface expression of the human P-glycoprotein.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16210410 2005 Differential expression profiling of membrane proteins by quantitative proteomics in a human mesenchymal stem cell line undergoing osteoblast differentiation.
More...