Property Summary

NCBI Gene PubMed Count 12
PubMed Score 18.13
PubTator Score 29.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
group 3 medulloblastoma 1.300 1.6e-03
intraductal papillary-mucinous adenoma (... 1.200 2.7e-03
intraductal papillary-mucinous carcinoma... 1.300 5.2e-03
lung adenocarcinoma 1.300 3.6e-11
lung cancer 2.000 7.5e-05
osteosarcoma -1.743 4.2e-04
ovarian cancer 2.700 2.3e-08
primitive neuroectodermal tumor 1.300 9.0e-03

Synonym

Accession Q9UHQ1 A6NCJ3 B3KPX2 K4DI98 Q96AY9 Q9BWC6
Symbols IOP2

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (8)

AA Sequence

MKCEHCTRKECSKKTKTDDQENVSADAPSPAQENGEKGEFHKLADAKIFLSDCLACDSCMTAEEGVQLSQ      1 - 70
QNAKDFFRVLNLNKKCDTSKHKVLVVSVCPQSLPYFAAKFNLSVTDASRRLCGFLKSLGVHYVFDTTIAA     71 - 140
DFSILESQKEFVRRYRQHSEEERTLPMLTSACPGWVRYAERVLGRPITAHLCTAKSPQQVMGSLVKDYFA    141 - 210
RQQNLSPEKIFHVIVAPCYDKKLEALQESLPPALHGSRGADCVLTSGEIAQIMEQGDLSVRDAAVDTLFG    211 - 280
DLKEDKVTRHDGASSDGHLAHIFRHAAKELFNEDVEEVTYRALRNKDFQEVTLEKNGEVVLRFAAAYGFR    281 - 350
NIQNMILKLKKGKFPFHFVEVLACAGGCLNGRGQAQTPDGHADKALLRQMEGIYADIPVRRPESSAHVQE    351 - 420
LYQEWLEGINSPKAREVLHTTYQSQERGTHSLDIKW                                      421 - 456
//

Text Mined References (15)

PMID Year Title