Property Summary

NCBI Gene PubMed Count 12
PubMed Score 17.85
PubTator Score 29.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Synonym

Accession Q9UHQ1 A6NCJ3 B3KPX2 K4DI98 Q96AY9 Q9BWC6
Symbols IOP2

Gene

PANTHER Protein Class (2)

Gene RIF (8)

PMID Text
20970119 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18680752 Data suggest that gorilla, chimpanzee, and human nuclear prelamin A recognition factor genes exemplify the versatile interplay of pre- and posttranscriptional modifications leading to novel genetic potential.
17709742 In both human and mouse fibroblasts, HIV-1 protease inhibitors inhibit ZMPSTE24, resulting in a significant accumulation of prelamin A, suggesting the interaction between HIV-1 PR and prelamin A
17654502 Prelamin A processing is linked to heterochromatin organization.
17652517 In both human and mouse fibroblasts, HIV-1 protease inhibitors inhibit ZMPSTE24, resulting in a significant accumulation of prelamin A, suggesting the interaction between HIV-1 PR and prelamin A
17326827 RNA editing enables exonization of a nuclear prelamin A recognition factor Alu-exon.
17326827 Creation of a novel Alu-exon and elimination of a premature stop codon by RNA editing.

AA Sequence

MKCEHCTRKECSKKTKTDDQENVSADAPSPAQENGEKGEFHKLADAKIFLSDCLACDSCMTAEEGVQLSQ      1 - 70
QNAKDFFRVLNLNKKCDTSKHKVLVVSVCPQSLPYFAAKFNLSVTDASRRLCGFLKSLGVHYVFDTTIAA     71 - 140
DFSILESQKEFVRRYRQHSEEERTLPMLTSACPGWVRYAERVLGRPITAHLCTAKSPQQVMGSLVKDYFA    141 - 210
RQQNLSPEKIFHVIVAPCYDKKLEALQESLPPALHGSRGADCVLTSGEIAQIMEQGDLSVRDAAVDTLFG    211 - 280
DLKEDKVTRHDGASSDGHLAHIFRHAAKELFNEDVEEVTYRALRNKDFQEVTLEKNGEVVLRFAAAYGFR    281 - 350
NIQNMILKLKKGKFPFHFVEVLACAGGCLNGRGQAQTPDGHADKALLRQMEGIYADIPVRRPESSAHVQE    351 - 420
LYQEWLEGINSPKAREVLHTTYQSQERGTHSLDIKW                                      421 - 456
//

Text Mined References (15)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20970119 2011 Convergent animal and human evidence suggests a role of PPM1A gene in response to antidepressants.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18680752 2008 Beyond DNA: RNA editing and steps toward Alu exonization in primates.
17654502 2007 Pre-Lamin A processing is linked to heterochromatin organization.
17326827 2007 RNA-editing-mediated exon evolution.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15667261 2005 Eukaryotic Fe-hydrogenases -- old eukaryotic heritage or adaptive acquisitions?
More...