Property Summary

NCBI Gene PubMed Count 14
PubMed Score 17.25
PubTator Score 13.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Deafness, X-Linked 4 1 0.0 0.0
Disease Target Count Z-score Confidence
Nonsyndromic deafness 142 4.12 2.1
Disease Target Count Z-score Confidence
Sensorineural hearing loss 106 4.112 2.1
Retinoschisis 10 3.472 1.7
Disease Target Count
SMPX 1

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.700 2.0e-02
Astrocytoma, Pilocytic -1.300 2.4e-04
colon cancer -3.700 2.4e-06
ependymoma -1.700 3.5e-02
glioblastoma -1.200 1.7e-04
group 3 medulloblastoma -1.800 3.8e-03
lung cancer 1.400 2.2e-04
oligodendroglioma -1.700 1.7e-02
pediatric high grade glioma -1.100 1.8e-03
primitive neuroectodermal tumor -1.900 6.7e-04

Synonym

Accession Q9UHP9 B1AWX2
Symbols DFN6
DFNX4

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

Gene RIF (7)

AA Sequence

MNMSKQPVSNVRAIQANINIPMGAFRPGAGQPPRRKECTPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNL      1 - 70
SEIQNIKSELKYVPKAEQ                                                         71 - 88
//

Text Mined References (15)

PMID Year Title