Property Summary

NCBI Gene PubMed Count 22
Grant Count 5
Funding $400,120.25
PubMed Score 22.47
PubTator Score 19.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
cutaneous lupus erythematosus 1.700 0.004
psoriasis -3.000 0.000
osteosarcoma -2.615 0.000
tuberculosis and treatment for 6 months -1.100 0.020
lung cancer -1.500 0.001
interstitial cystitis 1.400 0.020
sonic hedgehog group medulloblastoma 1.100 0.000
lung carcinoma -1.900 0.000
head and neck cancer -1.100 0.009

Gene RIF (17)

PMID Text
26829983 these data suggest that LLT1-CD161 interactions play a novel and important role in B cell maturation within the Germinal center in humans.
26147876 In RA joints, LLT1 is expressed by cells of the monocyte/macrophage lineage.
25760607 The hexamer of glycosylated LLT1 consists of three classical dimers. The hexameric packing may indicate a possible mode of interaction of C-type lectin-like proteins in the glycosylated form.
23333304 HIV-1 Vif downregulates the expression of C-type lectin domain family 2, member D (CLEC2D) in Vif-expression T cells
22664939 One polymorphism in LLT1 was found to be associated with our Crohn's Disease population (P<0.034).Our Ulcerative Colitis cohort was not associated with the variation in LLT1 (P=0.33)
21930700 LLT1 and CD161 have roles in modulating immune responses to pathogens; and interferon-gamma contributes to modulate immune responses
21572041 Molecular basis for LLT1 protein recognition by human CD161 protein (NKRP1A/KLRB1).
20843815 Data show that only CLEC2D isoform 1 (LLT1) is expressed on the cell surface.
20415786 LLT1 used Src-PTK, p38 and ERK signalling pathways, but not PKC, PI3K or calcineurin pathways, to increase production of IFN-gamma by human natural killer cells.
18593762 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MHDSNNVEKDITPSELPANPGCLHSKEHSIKATLIWRLFFLIMFLTIIVCGMVAALSAIRANCHQEPSVC      1 - 70
LQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQG     71 - 140
QPWKWINGTEWTRQFPILGAGECAYLNDKGASSARHYTERKWICSKSDIHV                       141 - 191
//

Text Mined References (24)

PMID Year Title
26829983 2016 LLT1 and CD161 Expression in Human Germinal Centers Promotes B Cell Activation and CXCR4 Downregulation.
26147876 2015 Expression of Lectin-Like Transcript 1, the Ligand for CD161, in Rheumatoid Arthritis.
25760607 2015 Four crystal structures of human LLT1, a ligand of human NKR-P1, in varied glycosylation and oligomerization states.
22664939 2012 Single nucleotide polymorphisms in C-type lectin genes, clustered in the IBD2 and IBD6 susceptibility loci, may play a role in the pathogenesis of inflammatory bowel diseases.
21930700 2011 Induction of lectin-like transcript 1 (LLT1) protein cell surface expression by pathogens and interferon-? contributes to modulate immune responses.
21572041 2011 Molecular basis for LLT1 protein recognition by human CD161 protein (NKRP1A/KLRB1).
20843815 2010 Characterization of alternatively spliced transcript variants of CLEC2D gene.
20415786 2010 LLT1-mediated activation of IFN-gamma production in human natural killer cells involves ERK signalling pathway.
18593762 2008 Polymorphisms in CLEC16A and CIITA at 16p13 are associated with primary adrenal insufficiency.
18465072 2008 The Asn19Lys substitution in the osteoclast inhibitory lectin (OCIL) gene is associated with a reduction of bone mineral density in postmenopausal women.
More...