Property Summary

NCBI Gene PubMed Count 22
PubMed Score 24.92
PubTator Score 19.85

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
cutaneous lupus erythematosus 1.700 4.1e-03
head and neck cancer -1.100 8.7e-03
interstitial cystitis 1.400 2.0e-02
lung cancer -1.400 2.7e-02
lung carcinoma -1.900 5.4e-19
osteosarcoma -2.615 7.2e-05
psoriasis -3.000 1.3e-05
sonic hedgehog group medulloblastoma 1.100 2.9e-07
tuberculosis and treatment for 6 months -1.100 2.0e-02

 GWAS Trait (1)

Gene RIF (17)

AA Sequence

MHDSNNVEKDITPSELPANPGCLHSKEHSIKATLIWRLFFLIMFLTIIVCGMVAALSAIRANCHQEPSVC      1 - 70
LQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQG     71 - 140
QPWKWINGTEWTRQFPILGAGECAYLNDKGASSARHYTERKWICSKSDIHV                       141 - 191
//

Text Mined References (25)

PMID Year Title