Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.63
PubTator Score 1.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 4.1e-27
nasopharyngeal carcinoma 1058 1.1e-07
ependymoma 4679 1.9e-04
cutaneous lupus erythematosus 1057 4.9e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Duodenum adenocarcinoma 4 4.261 2.1
Rhabdoid cancer 5 3.14 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
cutaneous lupus erythematosus -1.200 4.9e-04
ependymoma 1.200 1.9e-04
nasopharyngeal carcinoma -1.300 1.1e-07
psoriasis -1.300 4.1e-27

AA Sequence

MAHSQNSLELPININATQITTAYGHRALPKLKEELQSEDLQTRQKALMALCDLMHDPECIYKAMNIGCME      1 - 70
NLKALLKDSNSMVRIKTTEVLHITASHSVGRYAFLEHDIVLALSFLLNDPSPVCRGNLYKAYMQLVQVPR     71 - 140
GAQEIISKGLISSLVWKLQVEVEEEEFQEFILDTLVLCLQEDATEALGSNVVLVLKQKLLSANQNIRSKA    141 - 210
ARALLNVSISREGKKQVCHFDVIPILVHLLKDPVEHVKSNAAGALMFATVITEGKYAALEAQAIGLLLEL    211 - 280
LHSPMTIARLNATKALTMLAEAPEGRKALQTHVPTFRAMEVETYEKPQVAEALQRAARIAISVIEFKP      281 - 348
//

Text Mined References (9)

PMID Year Title