Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.69
PubTator Score 1.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
cutaneous lupus erythematosus -1.200 0.000
posterior fossa group B ependymoma 2.200 0.000
nasopharyngeal carcinoma -1.300 0.000
psoriasis -1.300 0.000

Synonym

Accession Q9UHP6
Symbols RTDR1

Gene

 Compartment GO Term (0)

AA Sequence

MAHSQNSLELPININATQITTAYGHRALPKLKEELQSEDLQTRQKALMALCDLMHDPECIYKAMNIGCME      1 - 70
NLKALLKDSNSMVRIKTTEVLHITASHSVGRYAFLEHDIVLALSFLLNDPSPVCRGNLYKAYMQLVQVPR     71 - 140
GAQEIISKGLISSLVWKLQVEVEEEEFQEFILDTLVLCLQEDATEALGSNVVLVLKQKLLSANQNIRSKA    141 - 210
ARALLNVSISREGKKQVCHFDVIPILVHLLKDPVEHVKSNAAGALMFATVITEGKYAALEAQAIGLLLEL    211 - 280
LHSPMTIARLNATKALTMLAEAPEGRKALQTHVPTFRAMEVETYEKPQVAEALQRAARIAISVIEFKP      281 - 348
//

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22504420 2012 Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10607907 2000 Isolation of genes from the rhabdoid tumor deletion region in chromosome band 22q11.2.
10591208 1999 The DNA sequence of human chromosome 22.