Property Summary

NCBI Gene PubMed Count 24
Grant Count 6
R01 Count 1
Funding $407,991.17
PubMed Score 18.59
PubTator Score 19.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.300 0.027
medulloblastoma -1.400 0.000
medulloblastoma, large-cell -1.100 0.002
non-small cell lung cancer -1.269 0.000
Breast cancer 2.300 0.026
lung carcinoma -1.300 0.000
spina bifida -1.808 0.042
invasive ductal carcinoma -1.100 0.001
ovarian cancer 1.400 0.003

Gene RIF (13)

PMID Text
25929833 REM Sleep Behavior Disorder patients with homozygous USP25 rs2823357 progressed to synucleinopathies faster than others.
25755282 Findings suggest that ubiquitin-specific protease 25 (USP25) as a VRK2 substrate that acts on TRiC deubiquitination.
24997798 These findings indicate that miR-200c exerts tumor-suppressive effects for NSCLC through the suppression of USP25 expression and suggests a new therapeutic application of miR-200c in the treatment of NSCLC.
24260525 USP25 is a novel deubiquitinating enzyme negatively regulating virus-induced interferon-beta production.
22590560 a model where USP25 counteracts ubiquitination of ERAD substrates by the ubiquitin ligase HRD1, rescuing them from degradation by the proteasome.
21480003 Studies indicate that DUBs recycle ubiquitin by processing polyubiquitin chains to generate free ubiquitin, and can be regulated by ubiquitination or phosphorylation.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19909739 the second SH2 domain of SYK physically interacts with a tyrosine-rich, C-terminal region of USP25 independently of tyrosine phosphorylation
19760754 Observational study of gene-disease association. (HuGE Navigator)
19440361 Data show that USP25m is regulated through alternative conjugation of ubiquitin (activating) or SUMO (inhibiting) to the same lysine residue (K99), which may promote the interaction with distinct intramolecular regulatory domains.
More...

AA Sequence

MTVEQNVLQQSAAQKHQQTFLNQLREITGINDTQILQQALKDSNGNLELAVAFLTAKNAKTPQQEETTYY      1 - 70
QTALPGNDRYISVGSQADTNVIDLTGDDKDDLQRAIALSLAESNRAFRETGITDEEQAISRVLEASIAEN     71 - 140
KACLKRTPTEVWRDSRNPYDRKRQDKAPVGLKNVGNTCWFSAVIQSLFNLLEFRRLVLNYKPPSNAQDLP    141 - 210
RNQKEHRNLPFMRELRYLFALLVGTKRKYVDPSRAVEILKDAFKSNDSQQQDVSEFTHKLLDWLEDAFQM    211 - 280
KAEEETDEEKPKNPMVELFYGRFLAVGVLEGKKFENTEMFGQYPLQVNGFKDLHECLEAAMIEGEIESLH    281 - 350
SENSGKSGQEHWFTELPPVLTFELSRFEFNQALGRPEKIHNKLEFPQVLYLDRYMHRNREITRIKREEIK    351 - 420
RLKDYLTVLQQRLERYLSYGSGPKRFPLVDVLQYALEFASSKPVCTSPVDDIDASSPPSGSIPSQTLPST    421 - 490
TEQQGALSSELPSTSPSSVAAISSRSVIHKPFTQSRIPPDLPMHPAPRHITEEELSVLESCLHRWRTEIE    491 - 560
NDTRDLQESISRIHRTIELMYSDKSMIQVPYRLHAVLVHEGQANAGHYWAYIFDHRESRWMKYNDIAVTK    561 - 630
SSWEELVRDSFGGYRNASAYCLMYINDKAQFLIQEEFNKETGQPLVGIETLPPDLRDFVEEDNQRFEKEL    631 - 700
EEWDAQLAQKALQEKLLASQKLRESETSVTTAQAAGDPEYLEQPSRSDFSKHLKEETIQIITKASHEHED    701 - 770
KSPETVLQSAIKLEYARLVKLAQEDTPPETDYRLHHVVVYFIQNQAPKKIIEKTLLEQFGDRNLSFDERC    771 - 840
HNIMKVAQAKLEMIKPEEVNLEEYEEWHQDYRKFRETTMYLIIGLENFQRESYIDSLLFLICAYQNNKEL    841 - 910
LSKGLYRGHDEELISHYRRECLLKLNEQAAELFESGEDREVNNGLIIMNEFIVPFLPLLLVDEMEEKDIL    911 - 980
AVEDMRNRWCSYLGQEMEPHLQEKLTDFLPKLLDCSMEIKSFHEPPKLPSYSTHELCERFARIMLSLSRT    981 - 1050
PADGR                                                                    1051 - 1055
//

Text Mined References (27)

PMID Year Title
25929833 2015 Parkinson's Disease Genetic Loci in Rapid Eye Movement Sleep Behavior Disorder.
25755282 2015 Vaccinia-Related Kinase 2 Controls the Stability of the Eukaryotic Chaperonin TRiC/CCT by Inhibiting the Deubiquitinating Enzyme USP25.
25416956 2014 A proteome-scale map of the human interactome network.
24997798 2014 miRNA-200c inhibits invasion and metastasis of human non-small cell lung cancer by directly targeting ubiquitin specific peptidase 25.
24260525 2013 Ubiquitin-specific proteases 25 negatively regulates virus-induced type I interferon signaling.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22590560 2012 Ubiquitin-specific protease 25 functions in Endoplasmic Reticulum-associated degradation.
21738487 2011 Web-based genome-wide association study identifies two novel loci and a substantial genetic component for Parkinson's disease.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21480003 2011 PTMs in conversation: activity and function of deubiquitinating enzymes regulated via post-translational modifications.
More...