Property Summary

NCBI Gene PubMed Count 29
PubMed Score 20.30
PubTator Score 33.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.400 1.2e-03
medulloblastoma, large-cell 1.300 9.4e-04
osteosarcoma -1.148 2.3e-04

Protein-protein Interaction (5)

Gene RIF (16)

AA Sequence

MRSRVAVRACHKVCRCLLSGFGGRVDAGQPELLTERSSPKGGHVKSHAELEGNGEHPEAPGSGEGSEALL      1 - 70
EICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGPLLP     71 - 140
GDSAFRLVSAETLREILQDKELSKEQLVAFLENVLKTSGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQ    141 - 210
IGVCFHPVFDTKQIRNGVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQD    211 - 280
EEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYL    281 - 350
YDSFQLTENSFTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLET    351 - 420
MQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV         421 - 485
//

Text Mined References (33)

PMID Year Title