Property Summary

NCBI Gene PubMed Count 35
Grant Count 211
R01 Count 149
Funding $42,799,056.57
PubMed Score 537.26
PubTator Score 38.79

Knowledge Summary

Patent (24,698)

Expression

Synonym

Accession Q9UHM6 B7ZLB3 Q14D01 Q2PP22 Q8NGQ9
Symbols MOP

Gene

PANTHER Protein Class (2)

Gene RIF (25)

PMID Text
25741728 By broadening the tuning of intrinsically photosensitive retinal ganglion cells, melanopsin tristability produces signal integration.
25313040 The response of the human pupil to the separate stimulation of the cones and melanopsin at a range of temporal frequencies under photopic conditions, was measured.
24909488 The light-induced FOS response in melanopsin expressing HEK-293 cells is correlated with melanopsin quantity and dependent on light duration and irradiance.
24887407 Studied OPN4*Ile394Thr gene polymorphism in association with sleep/wake timing.
24449866 A comparison of melanopsin with the mechanisms documented for vertebrate (bovine) and invertebrate (squid) visual photoreceptors shows that such a mechanism is not affected by the diversity of the three chromophore cavities.
24119231 Studied the association between melanopsin gene polymorphism and pupillary light reflex under diverse photic conditions, including different intensities and wavelengths.
23809464 The results of this study showed that the post illumination pupil response varied on the basis of OPN4 I394T genotype among individuals with seasonal affective disorder.
23555953 Significant interaction between the genotype of I394T (TT versus TC+CC) and luminance levels was found in pupil size.
23554393 An action spectrum for the calcium response in cells expressing human melanopsin had the predicted form for an opsin : vitamin A1 pigment and peaked at 479 nm. The G-protein selectivity and spectral sensitivity of human melanopsin is similar to that previously described for rodents.
23055493 The relative contribution of melanopsin and visual photoreceptors are assessed by comparing pupillary light reflex responses in a totally visually blind patient with normally sighted individuals.
More...

AA Sequence

MNPPSGPRVPPSPTQEPSCMATPAPPSWWDSSQSSISSLGRLPSISPTAPGTWAAAWVPLPTVDVPDHAH      1 - 70
YTLGTVILLVGLTGMLGNLTVIYTFCRSRSLRTPANMFIINLAVSDFLMSFTQAPVFFTSSLYKQWLFGE     71 - 140
TGCEFYAFCGALFGISSMITLTAIALDRYLVITRPLATFGVASKRRAAFVLLGVWLYALAWSLPPFFGWS    141 - 210
AYVPEGLLTSCSWDYMSFTPAVRAYTMLLCCFVFFLPLLIIIYCYIFIFRAIRETGRALQTFGACKGNGE    211 - 280
SLWQRQRLQSECKMAKIMLLVILLFVLSWAPYSAVALVAFAGYAHVLTPYMSSVPAVIAKASAIHNPIIY    281 - 350
AITHPKYRVAIAQHLPCLGVLLGVSRRHSRPYPSYRSTHRSTLTSHTSNLSWISIRRRQESLGSESEVGW    351 - 420
THMEAAAVWGAAQQANGRSLYGQGLEDLEAKAPPRPQGHEAETPGKTKGLIPSQDPRM                421 - 478
//

Text Mined References (35)

PMID Year Title
25741728 2015 Melanopsin tristability for sustained and broadband phototransduction.
25313040 2014 Opponent melanopsin and S-cone signals in the human pupillary light response.
24909488 The light-induced FOS response in melanopsin expressing HEK-293 cells is correlated with melanopsin quantity and dependent on light duration and irradiance.
24887407 2014 Association between the melanopsin gene polymorphism OPN4*Ile394Thr and sleep/wake timing in Japanese university students.
24449866 2014 Comparison of the isomerization mechanisms of human melanopsin and invertebrate and vertebrate rhodopsins.
24119231 2013 Association between melanopsin gene polymorphism (I394T) and pupillary light reflex is dependent on light wavelength.
23809464 2013 The post illumination pupil response is reduced in seasonal affective disorder.
23555953 2013 Melanopsin gene polymorphism I394T is associated with pupillary light responses in a dose-dependent manner.
23554393 2013 Human melanopsin forms a pigment maximally sensitive to blue light (?max ? 479 nm) supporting activation of G(q/11) and G(i/o) signalling cascades.
23055493 2012 Melanopsin and rod-cone photoreceptors play different roles in mediating pupillary light responses during exposure to continuous light in humans.
More...