Property Summary

NCBI Gene PubMed Count 20
PubMed Score 163.32
PubTator Score 91.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Necrosis 51
Disease Target Count P-value
ovarian cancer 8492 2.70298254239664E-6
group 4 medulloblastoma 1875 3.07346538553889E-4
atypical teratoid / rhabdoid tumor 4369 0.00150270782500212
subependymal giant cell astrocytoma 2287 0.0255431303341106
Disease Target Count Z-score Confidence
Deafness dystonia syndrome 20 3.011 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 0.002
group 4 medulloblastoma -1.500 0.000
subependymal giant cell astrocytoma 1.052 0.026
ovarian cancer 1.800 0.000

Synonym

Accession Q9UHL4 A8K7U7 Q5VSF1 Q969X4
Symbols QPP
DPP2
DPPII

Gene

PANTHER Protein Class (3)

PDB

3JYH   3N0T   4EBB  

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (5)

PMID Text
22952628 human DPP7 structures reveal the molecular basis of specific inhibition and the architectural diversity of proline-specific peptidases
20534982 The constitutive expression of dipeptidyl peptidase II mRNA in chronic lymphocytic leukemia was demonstrated.
19556882 DPP2 is essential for maintaining lymphocytes and fibroblasts in G(0), and its inhibition results in apoptosis mediated by induction of c-Myc and p53.
18823758 DPP II plays a minor role in the progression of malignant melanocytic lesions
12529175 catalytic properties and inhibition of this proline-specific enzyme

AA Sequence

MGSAPWAPVLLLALGLRGLQAGARRAPDPGFQERFFQQRLDHFNFERFGNKTFPQRFLVSDRFWVRGEGP      1 - 70
IFFYTGNEGDVWAFANNSAFVAELAAERGALLVFAEHRYYGKSLPFGAQSTQRGHTELLTVEQALADFAE     71 - 140
LLRALRRDLGAQDAPAIAFGGSYGGMLSAYLRMKYPHLVAGALAASAPVLAVAGLGDSNQFFRDVTADFE    141 - 210
GQSPKCTQGVREAFRQIKDLFLQGAYDTVRWEFGTCQPLSDEKDLTQLFMFARNAFTVLAMMDYPYPTDF    211 - 280
LGPLPANPVKVGCDRLLSEAQRITGLRALAGLVYNASGSEHCYDIYRLYHSCADPTGCGTGPDARAWDYQ    281 - 350
ACTEINLTFASNNVTDMFPDLPFTDELRQRYCLDTWGVWPRPDWLLTSFWGGDLRAASNIIFSNGNLDPW    351 - 420
AGGGIRRNLSASVIAVTIQGGAHHLDLRASHPEDPASVVEARKLEATIIGEWVKAARREQQPALRGGPRL    421 - 490
SL                                                                        491 - 492
//

Text Mined References (27)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22952628 2012 Structures of human DPP7 reveal the molecular basis of specific inhibition and the architectural diversity of proline-specific peptidases.
21269460 2011 Initial characterization of the human central proteome.
20534982 2010 Expression and prognostic assessment of dipeptidyl peptidase IV and related enzymes in B-cell chronic lymphocytic leukemia.
19556882 2009 Dipeptidyl peptidase 2 is an essential survival factor in the regulation of cell quiescence.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18823758 2009 Dipeptidyl peptidase II is not a marker for progression in melanoma.
More...