Property Summary

NCBI Gene PubMed Count 12
PubMed Score 20.94
PubTator Score 15.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
ependymoma -1.900 0.006
glioblastoma -2.400 0.000
atypical teratoid / rhabdoid tumor -2.200 0.000
medulloblastoma -1.100 0.006
medulloblastoma, large-cell -1.400 0.002
pediatric high grade glioma -2.000 0.000
pilocytic astrocytoma -1.200 0.000
subependymal giant cell astrocytoma -1.820 0.018
lung carcinoma 3.400 0.000
Pick disease -1.300 0.007
psoriasis -2.000 0.000

Synonym

Accession Q9UHL0 B2R6Z0 Q5XVN2 Q86W81 Q8IYP1
Symbols GRTH

Gene

PDB

2RB4  

Gene RIF (9)

PMID Text
24168058 Analysed the association of GRTH gene IVS6+55G/T and c.852C/T polymorphisms with male infertility. The c.852 T allele was associated with an increased risk of male infertility (OR: 3.16, P = 0.008), whereas IVS6+55G/T allele conferred no risk.
20378615 Observational study of gene-disease association. (HuGE Navigator)
19875492 multifunctional RNA helicase that is an essential regulator of spermatogenesis
19536092 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17889551 The association of GRTH mutations with male infertility underlines the importance of GRTH as a central, post-transcriptional regulator of spermatogenesis.
17848414 Data show that the Arg(242)His missense mutation of the GRTH/DDX25 gene associated with expression of a protein with reduced basicity, and the absence of the phospho-GRTH species, could impact on germ cell development and/or function.
17848414 Observational study of gene-disease association. (HuGE Navigator)
16293649 Observational study of gene-disease association. (HuGE Navigator)
16293649 SNP IVS6+55G-->T and c.852C-->T of GRTH gene may be associated with male infertility with azoospermia or severe oligozoospermia.

AA Sequence

MASLLWGGDAGAAESERLNSHFSNLSQPRKNLWGIKSTAVRNIDGSINNINEDDEEDVVDLAANSLLNKL      1 - 70
IHQSLVESSHRVEVLQKDPSSPLYSVKTFEELRLKEELLKGIYAMGFNRPSKIQEMALPMMLAHPPQNLI     71 - 140
AQSQSGTGKTAAFVLAMLSRVNALELFPQCLCLAPTYELALQTGRVVEQMGKFCVDVQVMYAIRGNRIPR    141 - 210
GTDITKQIIIGTPGTVLDWCFKLKLIDLTKIRVFVLDEADVMIDTQGFSDHSIRIQRALPSECQMLLFSA    211 - 280
TFEDSVWHFAERIIPDPNVIKLRKEELTLNNIRQYYVLCEHRKDKYQALCNIYGSITIGQAIIFCQTRRN    281 - 350
AKWLTVEMIQDGHQVSLLSGELTVEQRASIIQRFRDGKEKVLITTNVCARGIDVKQVTIVVNFDLPVKQG    351 - 420
EEPDYETYLHRIGRTGRFGKKGLAFNMIEVDELPSLMKIQDHFNSSIKQLNAEDMDEIEKIDY           421 - 483
//

Text Mined References (14)

PMID Year Title
24168058 2014 Association of the gonadotrophin-regulated testicular RNA helicase gene polymorphism with human male infertility.
20941364 2010 Comparative structural analysis of human DEAD-box RNA helicases.
20378615 2010 Evaluation of 172 candidate polymorphisms for association with oligozoospermia or azoospermia in a large cohort of men of European descent.
19875492 Gonadotropin-regulated testicular RNA helicase (GRTH/DDX25): a multifunctional protein essential for spermatogenesis.
19536092 2009 Explorative study to identify novel candidate genes related to oxaliplatin efficacy and toxicity using a DNA repair array.
17889551 2007 Gonadotropin-regulated testicular helicase (GRTH/DDX25): an essential regulator of spermatogenesis.
17848414 2007 Polymorphism of the GRTH/DDX25 gene in normal and infertile Japanese men: a missense mutation associated with loss of GRTH phosphorylation.
16293649 2006 Single nucleotide polymorphisms of the gonadotrophin-regulated testicular helicase (GRTH) gene may be associated with the human spermatogenesis impairment.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15096601 2004 Gonadotropin-regulated testicular RNA helicase (GRTH/Ddx25) is essential for spermatid development and completion of spermatogenesis.
More...