Property Summary

NCBI Gene PubMed Count 12
PubMed Score 20.94
PubTator Score 15.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 4.6776270043519E-52
lung carcinoma 2844 1.44772182361037E-49
pediatric high grade glioma 2712 4.4166367131078E-5
atypical teratoid / rhabdoid tumor 4369 8.11726165002019E-5
pilocytic astrocytoma 3086 1.42892591045586E-4
glioblastoma 5572 2.59162290334193E-4
medulloblastoma, large-cell 6234 0.00229389873941054
ependymoma 2514 0.00564234360327947
medulloblastoma 1524 0.00641097271896531
Pick disease 1893 0.00740044571995003
subependymal giant cell astrocytoma 2287 0.0177833909708445
Disease Target Count Z-score Confidence
Hydrolethalus syndrome 128 4.942 2.5
Male infertility 170 4.607 2.3

Expression

  Differential Expression (11)

Disease log2 FC p
ependymoma -1.900 0.006
glioblastoma -2.400 0.000
atypical teratoid / rhabdoid tumor -2.200 0.000
medulloblastoma -1.100 0.006
medulloblastoma, large-cell -1.400 0.002
pediatric high grade glioma -2.000 0.000
pilocytic astrocytoma -1.200 0.000
subependymal giant cell astrocytoma -1.820 0.018
lung carcinoma 3.400 0.000
Pick disease -1.300 0.007
psoriasis -2.000 0.000

Synonym

Accession Q9UHL0 B2R6Z0 Q5XVN2 Q86W81 Q8IYP1
Symbols GRTH

Gene

PDB

2RB4  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG

Pathway (1)

Gene RIF (9)

PMID Text
24168058 Analysed the association of GRTH gene IVS6+55G/T and c.852C/T polymorphisms with male infertility. The c.852 T allele was associated with an increased risk of male infertility (OR: 3.16, P = 0.008), whereas IVS6+55G/T allele conferred no risk.
20378615 Observational study of gene-disease association. (HuGE Navigator)
19875492 multifunctional RNA helicase that is an essential regulator of spermatogenesis
19536092 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17889551 The association of GRTH mutations with male infertility underlines the importance of GRTH as a central, post-transcriptional regulator of spermatogenesis.
17848414 Data show that the Arg(242)His missense mutation of the GRTH/DDX25 gene associated with expression of a protein with reduced basicity, and the absence of the phospho-GRTH species, could impact on germ cell development and/or function.
17848414 Observational study of gene-disease association. (HuGE Navigator)
16293649 Observational study of gene-disease association. (HuGE Navigator)
16293649 SNP IVS6+55G-->T and c.852C-->T of GRTH gene may be associated with male infertility with azoospermia or severe oligozoospermia.

AA Sequence

MASLLWGGDAGAAESERLNSHFSNLSQPRKNLWGIKSTAVRNIDGSINNINEDDEEDVVDLAANSLLNKL      1 - 70
IHQSLVESSHRVEVLQKDPSSPLYSVKTFEELRLKEELLKGIYAMGFNRPSKIQEMALPMMLAHPPQNLI     71 - 140
AQSQSGTGKTAAFVLAMLSRVNALELFPQCLCLAPTYELALQTGRVVEQMGKFCVDVQVMYAIRGNRIPR    141 - 210
GTDITKQIIIGTPGTVLDWCFKLKLIDLTKIRVFVLDEADVMIDTQGFSDHSIRIQRALPSECQMLLFSA    211 - 280
TFEDSVWHFAERIIPDPNVIKLRKEELTLNNIRQYYVLCEHRKDKYQALCNIYGSITIGQAIIFCQTRRN    281 - 350
AKWLTVEMIQDGHQVSLLSGELTVEQRASIIQRFRDGKEKVLITTNVCARGIDVKQVTIVVNFDLPVKQG    351 - 420
EEPDYETYLHRIGRTGRFGKKGLAFNMIEVDELPSLMKIQDHFNSSIKQLNAEDMDEIEKIDY           421 - 483
//

Text Mined References (14)

PMID Year Title
24168058 2014 Association of the gonadotrophin-regulated testicular RNA helicase gene polymorphism with human male infertility.
20941364 2010 Comparative structural analysis of human DEAD-box RNA helicases.
20378615 2010 Evaluation of 172 candidate polymorphisms for association with oligozoospermia or azoospermia in a large cohort of men of European descent.
19875492 Gonadotropin-regulated testicular RNA helicase (GRTH/DDX25): a multifunctional protein essential for spermatogenesis.
19536092 2009 Explorative study to identify novel candidate genes related to oxaliplatin efficacy and toxicity using a DNA repair array.
17889551 2007 Gonadotropin-regulated testicular helicase (GRTH/DDX25): an essential regulator of spermatogenesis.
17848414 2007 Polymorphism of the GRTH/DDX25 gene in normal and infertile Japanese men: a missense mutation associated with loss of GRTH phosphorylation.
16293649 2006 Single nucleotide polymorphisms of the gonadotrophin-regulated testicular helicase (GRTH) gene may be associated with the human spermatogenesis impairment.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15096601 2004 Gonadotropin-regulated testicular RNA helicase (GRTH/Ddx25) is essential for spermatid development and completion of spermatogenesis.
More...