Property Summary

NCBI Gene PubMed Count 12
PubMed Score 21.83
PubTator Score 15.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.700 7.1e-03
Astrocytoma, Pilocytic -1.200 1.5e-04
atypical teratoid / rhabdoid tumor -2.200 8.1e-05
ependymoma -1.900 5.6e-03
glioblastoma -1.400 7.8e-04
lung carcinoma 3.400 1.4e-49
medulloblastoma -1.100 6.4e-03
medulloblastoma, large-cell -1.400 2.3e-03
Pick disease -1.300 7.4e-03
psoriasis -2.000 4.7e-52
subependymal giant cell astrocytoma -1.820 1.8e-02

Gene RIF (9)

AA Sequence

MASLLWGGDAGAAESERLNSHFSNLSQPRKNLWGIKSTAVRNIDGSINNINEDDEEDVVDLAANSLLNKL      1 - 70
IHQSLVESSHRVEVLQKDPSSPLYSVKTFEELRLKEELLKGIYAMGFNRPSKIQEMALPMMLAHPPQNLI     71 - 140
AQSQSGTGKTAAFVLAMLSRVNALELFPQCLCLAPTYELALQTGRVVEQMGKFCVDVQVMYAIRGNRIPR    141 - 210
GTDITKQIIIGTPGTVLDWCFKLKLIDLTKIRVFVLDEADVMIDTQGFSDHSIRIQRALPSECQMLLFSA    211 - 280
TFEDSVWHFAERIIPDPNVIKLRKEELTLNNIRQYYVLCEHRKDKYQALCNIYGSITIGQAIIFCQTRRN    281 - 350
AKWLTVEMIQDGHQVSLLSGELTVEQRASIIQRFRDGKEKVLITTNVCARGIDVKQVTIVVNFDLPVKQG    351 - 420
EEPDYETYLHRIGRTGRFGKKGLAFNMIEVDELPSLMKIQDHFNSSIKQLNAEDMDEIEKIDY           421 - 483
//

Text Mined References (14)

PMID Year Title