Property Summary

NCBI Gene PubMed Count 104
PubMed Score 310.53
PubTator Score 308.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

Protein-protein Interaction (4)

Gene RIF (92)

AA Sequence

MALQGISVVELSGLAPGPFCAMVLADFGARVVRVDRPGSRYDVSRLGRGKRSLVLDLKQPRGAAVLRRLC      1 - 70
KRSDVLLEPFRRGVMEKLQLGPEILQRENPRLIYARLSGFGQSGSFCRLAGHDINYLALSGVLSKIGRSG     71 - 140
ENPYAPLNLLADFAGGGLMCALGIIMALFDRTRTGKGQVIDANMVEGTAYLSSFLWKTQKLSLWEAPRGQ    141 - 210
NMLDGGAPFYTTYRTADGEFMAVGAIEPQFYELLIKGLGLKSDELPNQMSMDDWPEMKKKFADVFAEKTK    211 - 280
AEWCQIFDGTDACVTPVLTFEEVVHHDHNKERGSFITSEEQDVSPRPAPLLLNTPAIPSFKRDPFIGEHT    281 - 350
EEILEEFGFSREEIYQLNSDKIIESNKVKASL                                          351 - 382
//

Text Mined References (110)

PMID Year Title