Property Summary

NCBI Gene PubMed Count 17
PubMed Score 112.01
PubTator Score 52.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (7)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.440 9.0e-05
group 3 medulloblastoma 1.100 1.1e-03
malignant mesothelioma 2.200 7.8e-08
osteosarcoma -2.114 8.6e-09
ovarian cancer 1.100 7.3e-06
psoriasis 1.500 1.6e-03
tuberculosis -1.300 2.6e-06

Gene RIF (8)

AA Sequence

MNGEQQLDADAGSGMEEVELSWEDYLEETGSTAVPYGSFKHVDTRLQNGFAPGMKLEVAVRTDPETYWVA      1 - 70
TVITTCEQLLLLRYDGYGEDRRADFWCDIRKADLYPIGWCEQNKKTLEAPEGIRDKVSDWDEFLRQTLIG     71 - 140
ACSPPVPLLEGLRNGRNPLDLIAPGSRLECQAFQDSLSTWIVTVVENIGGRLKLRYEGLESSDNYEHWLY    141 - 210
YLDPFLHHVGWAAQQGYELQPPSAIRHLKNEAEWQEILAKVKEEEEEPLPSYLFKDKQVIGIHTFSVNMK    211 - 280
LEAVDPWSPFGISPATVVKVFDEKYFLVEMDDLRPENHARRSFVCHADSPGIFPVQWSLKNGLHISPPPG    281 - 350
YPSQDFDWADYLKQCGAEAAPQRCFPPLISEHEFKENMKLEAVNPILPEEVCVATITAVRGSYLWLQLEG    351 - 420
SKKPIPECIVSVESMDIFPLGWCETNGHPLSTPRRARVYKQRKIAVVQPEKQVPSSRTVHEGLRNQELNS    421 - 490
TESVMINGKYCCPKIYFNHRCFSGPYLNKGRIAELPQCVGPGNCVLVLREVLTLLINAAYKPSRVLRELQ    491 - 560
LDKDSVWHGCGEVLKAKYKGKSYRATVEIVKTADRVTEFCRQTCIKLECCPNLFGPRMVLDKCSENCSVL    561 - 630
TKTKYTHYYGKKKNKRIGRPPGGHSNLACALKKASKRRKRRKNVFVHKKKRSSASVDNTPAGSPQGSGGE    631 - 700
DEDDPDEGDDDSLSEGSTSEQQDELQEESEMSEKKSCSSSPTQSEISTSLPPDRQRRKRELRTFSFSDDE    701 - 770
NKPPSPKEIRIEVAERLHLDSNPLKWSVADVVRFIRSTDCAPLARIFLDQEIDGQALLLLTLPTVQECMD    771 - 840
LKLGPAIKLCHHIERIKFAFYEQFAN                                                841 - 866
//

Text Mined References (22)

PMID Year Title