Property Summary

NCBI Gene PubMed Count 75
Grant Count 38
R01 Count 19
Funding $2,801,468.56
PubMed Score 263.74
PubTator Score 212.70

Knowledge Summary

Patent

No data available

Expression

Gene RIF (61)

PMID Text
26916548 progesterone acts via the progesterone receptor to modulate ADAMTS 1 and 4 levels in ovarian cancer cell lines.
26675551 High ADAMTS1 expression was significantly associated with tumorigenicity of Kaposi's sarcoma-associated herpesvirus infected endothelial cells.
26663063 Data suggest that the rs416905 and rs402007 single nucleotide polymorphisms of the a disintegrin and metallo-proteinase with thrombospondin type 1 motifs (ADAMTS-1) gene may be associated with ischemic stroke caused by large artery atherosclerosis (LAA).
26563155 increased expression of ADAMTS1 protein in macrophages and neutrophils that infiltrated aortic tissues may promote the progression of acute aortic dissection
26299656 Ectopic expression of SP1 and USF transcription factors resulted in the decrease in ADAMTS1 transcriptional activity of all promoter constructs
26124221 single-nucleotide missense mutation in the ADAMTS1 gene (c. 742I>T) was found to segregate in the family, given that the affected individuals must be heterozygous for the mutation
25998153 Results show that ADAMTS1 expression is negatively regulated in breast neoplasm cells due to mir-365 targeting its 3'UTR.
25936341 The aberrant methylation of ADAMTS1 may be involved in the development and progression of gastric cancer.
24998958 Data show that ADAMTS1 was expressed at a significantly higher level in extravillous trophoblast cells (EVTs) than in villous trophoblast cells (VTs), while both ADAM10 and ADAM12 were expressed at significantly higher levels in VTs than in EVTs.
24646063 Dysregulated expression of ADAMTS-1 in polycystic ovary syndrome may influence oocyte quality-via Granulosa cells-oocyte paracrine and endocrine mechanism.
More...

AA Sequence

MQRAVPEGFGRRKLGSDMGNAERAPGSRSFGPVPTLLLLAAALLAVSDALGRPSEEDEELVVPELERAPG      1 - 70
HGTTRLRLHAFDQQLDLELRPDSSFLAPGFTLQNVGRKSGSETPLPETDLAHCFYSGTVNGDPSSAAALS     71 - 140
LCEGVRGAFYLLGEAYFIQPLPAASERLATAAPGEKPPAPLQFHLLRRNRQGDVGGTCGVVDDEPRPTGK    141 - 210
AETEDEDEGTEGEDEGAQWSPQDPALQGVGQPTGTGSIRKKRFVSSHRYVETMLVADQSMAEFHGSGLKH    211 - 280
YLLTLFSVAARLYKHPSIRNSVSLVVVKILVIHDEQKGPEVTSNAALTLRNFCNWQKQHNPPSDRDAEHY    281 - 350
DTAILFTRQDLCGSQTCDTLGMADVGTVCDPSRSCSVIEDDGLQAAFTTAHELGHVFNMPHDDAKQCASL    351 - 420
NGVNQDSHMMASMLSNLDHSQPWSPCSAYMITSFLDNGHGECLMDKPQNPIQLPGDLPGTSYDANRQCQF    421 - 490
TFGEDSKHCPDAASTCSTLWCTGTSGGVLVCQTKHFPWADGTSCGEGKWCINGKCVNKTDRKHFDTPFHG    491 - 560
SWGMWGPWGDCSRTCGGGVQYTMRECDNPVPKNGGKYCEGKRVRYRSCNLEDCPDNNGKTFREEQCEAHN    561 - 630
EFSKASFGSGPAVEWIPKYAGVSPKDRCKLICQAKGIGYFFVLQPKVVDGTPCSPDSTSVCVQGQCVKAG    631 - 700
CDRIIDSKKKFDKCGVCGGNGSTCKKISGSVTSAKPGYHDIITIPTGATNIEVKQRNQRGSRNNGSFLAI    701 - 770
KAADGTYILNGDYTLSTLEQDIMYKGVVLRYSGSSAALERIRSFSPLKEPLTIQVLTVGNALRPKIKYTY    771 - 840
FVKKKKESFNAIPTFSAWVIEEWGECSKSCELGWQRRLVECRDINGQPASECAKEVKPASTRPCADHPCP    841 - 910
QWQLGEWSSCSKTCGKGYKKRSLKCLSHDGGVLSHESCDPLKKPKHFIDFCTMAECS                 911 - 967
//

Text Mined References (76)

PMID Year Title
26916548 2016 Progesterone acts via the progesterone receptor to induce adamts proteases in ovarian cancer cells.
26675551 2016 CD147 and downstream ADAMTSs promote the tumorigenicity of Kaposi's sarcoma-associated herpesvirus infected endothelial cells.
26663063 2015 [Association of ADAMTS-1 gene polymorphisms with ischemic stroke caused by large artery atherosclerosis].
26563155 2016 A disintegrin and metalloproteinase with thrombospondin motif 1 (ADAMTS1) expression increases in acute aortic dissection.
26299656 2016 SP1 and USF differentially regulate ADAMTS1 gene expression under normoxic and hypoxic conditions in hepatoma cells.
26124221 2015 The ADAMTS1 Gene Is Associated with Familial Mandibular Prognathism.
25998153 2015 miR?365 overexpression promotes cell proliferation and invasion by targeting ADAMTS-1 in breast cancer.
25936341 2015 Downregulation of A disintegrin and metallopeptidase with thrombospondin motif type 1 by DNA hypermethylation in human gastric cancer.
24998958 2014 Differential expression of ADAM (a disintegrin and metalloproteinase) genes between human first trimester villous and extravillous trophoblast cells.
24646063 2014 Evidence for decreased expression of ADAMTS-1 associated with impaired oocyte quality in PCOS patients.
More...