Property Summary

Ligand Count 3
NCBI Gene PubMed Count 86
PubMed Score 279.84
PubTator Score 212.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count
Alzheimer Disease 83

Expression

  Differential Expression (32)

Disease log2 FC p
acute quadriplegic myopathy 1.748 1.3e-04
adrenocortical adenoma -1.539 4.4e-02
adrenocortical carcinoma -2.034 2.2e-05
Amyotrophic lateral sclerosis 1.275 5.6e-05
atypical teratoid/rhabdoid tumor 1.300 3.2e-02
autosomal dominant Emery-Dreifuss muscul... 1.496 4.9e-03
Breast cancer -2.400 1.1e-07
breast carcinoma -1.500 1.0e-17
colon cancer -2.700 5.5e-03
Down syndrome 2.100 1.3e-03
ductal carcinoma in situ -1.100 2.3e-03
Endometriosis -1.050 2.2e-02
gastric carcinoma 2.500 2.4e-03
group 4 medulloblastoma -1.200 5.6e-03
Hydrolethalus syndrome 1.519 3.9e-02
intraductal papillary-mucinous adenoma (... -3.600 8.6e-05
intraductal papillary-mucinous carcinoma... -3.900 6.2e-05
intraductal papillary-mucinous neoplasm ... -3.900 6.5e-04
invasive ductal carcinoma -1.198 9.3e-03
lung adenocarcinoma -1.300 1.0e-07
lung cancer -2.900 3.0e-06
lung carcinoma -1.300 5.5e-06
malignant mesothelioma -1.700 1.0e-07
medulloblastoma, large-cell -1.500 2.2e-03
non-small cell lung cancer -1.864 2.2e-12
osteosarcoma 2.038 1.0e-02
pancreatic cancer 1.100 1.0e-02
pituitary cancer -2.500 8.2e-06
posterior fossa group B ependymoma -1.300 5.0e-04
primary pancreatic ductal adenocarcinoma 1.023 1.0e-02
psoriasis -1.800 9.6e-08
ulcerative colitis 2.600 2.1e-05

Gene RIF (72)

AA Sequence

MQRAVPEGFGRRKLGSDMGNAERAPGSRSFGPVPTLLLLAAALLAVSDALGRPSEEDEELVVPELERAPG      1 - 70
HGTTRLRLHAFDQQLDLELRPDSSFLAPGFTLQNVGRKSGSETPLPETDLAHCFYSGTVNGDPSSAAALS     71 - 140
LCEGVRGAFYLLGEAYFIQPLPAASERLATAAPGEKPPAPLQFHLLRRNRQGDVGGTCGVVDDEPRPTGK    141 - 210
AETEDEDEGTEGEDEGAQWSPQDPALQGVGQPTGTGSIRKKRFVSSHRYVETMLVADQSMAEFHGSGLKH    211 - 280
YLLTLFSVAARLYKHPSIRNSVSLVVVKILVIHDEQKGPEVTSNAALTLRNFCNWQKQHNPPSDRDAEHY    281 - 350
DTAILFTRQDLCGSQTCDTLGMADVGTVCDPSRSCSVIEDDGLQAAFTTAHELGHVFNMPHDDAKQCASL    351 - 420
NGVNQDSHMMASMLSNLDHSQPWSPCSAYMITSFLDNGHGECLMDKPQNPIQLPGDLPGTSYDANRQCQF    421 - 490
TFGEDSKHCPDAASTCSTLWCTGTSGGVLVCQTKHFPWADGTSCGEGKWCINGKCVNKTDRKHFDTPFHG    491 - 560
SWGMWGPWGDCSRTCGGGVQYTMRECDNPVPKNGGKYCEGKRVRYRSCNLEDCPDNNGKTFREEQCEAHN    561 - 630
EFSKASFGSGPAVEWIPKYAGVSPKDRCKLICQAKGIGYFFVLQPKVVDGTPCSPDSTSVCVQGQCVKAG    631 - 700
CDRIIDSKKKFDKCGVCGGNGSTCKKISGSVTSAKPGYHDIITIPTGATNIEVKQRNQRGSRNNGSFLAI    701 - 770
KAADGTYILNGDYTLSTLEQDIMYKGVVLRYSGSSAALERIRSFSPLKEPLTIQVLTVGNALRPKIKYTY    771 - 840
FVKKKKESFNAIPTFSAWVIEEWGECSKSCELGWQRRLVECRDINGQPASECAKEVKPASTRPCADHPCP    841 - 910
QWQLGEWSSCSKTCGKGYKKRSLKCLSHDGGVLSHESCDPLKKPKHFIDFCTMAECS                 911 - 967
//

Text Mined References (87)

PMID Year Title