Property Summary

NCBI Gene PubMed Count 62
PubMed Score 64.01
PubTator Score 61.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
active Crohn's disease -2.128 4.7e-03
active ulcerative colitis -2.592 4.6e-03
chronic rhinosinusitis -1.205 2.2e-02
cystic fibrosis and chronic rhinosinusit... -1.044 4.1e-02
osteosarcoma -1.218 1.6e-05
pancreatic ductal adenocarcinoma liver m... -1.151 3.2e-03

Gene RIF (46)

AA Sequence

MRAQEDLEGRTQHETTRDPSTPLPTEPKFDMLYKIEDVPPWYLCILLGFQHYLTCFSGTIAVPFLLAEAL      1 - 70
CVGHDQHMVSQLIGTIFTCVGITTLIQTTVGIRLPLFQASAFAFLVPAKAILALERWKCPPEEEIYGNWS     71 - 140
LPLNTSHIWHPRIREVQGAIMVSSVVEVVIGLLGLPGALLNYIGPLTVTPTVSLIGLSVFQAAGDRAGSH    141 - 210
WGISACSILLIILFSQYLRNLTFLLPVYRWGKGLTLLRIQIFKMFPIMLAIMTVWLLCYVLTLTDVLPTD    211 - 280
PKAYGFQARTDARGDIMAIAPWIRIPYPCQWGLPTVTAAAVLGMFSATLAGIIESIGDYYACARLAGAPP    281 - 350
PPVHAINRGIFTEGICCIIAGLLGTGNGSTSSSPNIGVLGITKVGSRRVVQYGAAIMLVLGTIGKFTALF    351 - 420
SSLPDPILGGMFCTLFGMITAVGLSNLQFVDMNSSRNLFVLGFSMFFGLTLPNYLESNPGAINTGILEVD    421 - 490
QILIVLLTTEMFVGGCLAFILDNTVPGSPEERGLIQWKAGAHANSDMSSSLKSYDFPIGMGIVKRITFLK    491 - 560
YIPICPVFKGFSSSSKDQIAIPEDTPENTETASVCTKV                                    561 - 598
//

Text Mined References (63)

PMID Year Title