Property Summary

NCBI Gene PubMed Count 61
Grant Count 18
Funding $2,526,883.17
PubMed Score 57.10
PubTator Score 61.99

Knowledge Summary

Patent

No data available

Expression

Gene RIF (45)

PMID Text
25933589 consensus site for HNF1 that is crucial for the regulation of the human SVCT1 promoter is present in the SVCT1 rat promoter but has no effect on its transcriptional activity
25527764 Data from observational/genetic association studies in Europe suggest an SNP in SLC23A1 (rs33972313) is associated with up-regulation of circulating L-ascorbic acid but not with any cardiometabolic/cardiovascular outcome investigated. [META-ANALYSIS]
24815519 polymorphisms in SLC23A1/2 genes influenced ascorbate concentration in aqueous humor and lens nucleus.
24708273 SNP rs6596473 of SLC23A1 is suggested to be associated with AgP. results add to previous reports vitamin C plays a role in pathogenesis of periodontitis.
24284447 A genetic variant in the SLC23A1 ascorbate transporter locus was identified and is associated with an increased risk of Crohn disease in a white Canadian inflammatory bowel diseases cohort.
23837633 Data suggest that N-terminal and C-terminal sorting signals interact, directly or indirectly, within each gene family (here, SVCT1 and SVCT2) in basolateral targeting of transmembrane proteins to basolateral cell membrane.
23613229 Data show that the mRNA level of svct2 was approximately 600- to 900-fold higher than that of svct1 indicating SVCT2 is a main isoform in fibroblast OUMS-36 cells, and no significant difference in svct2 mRNA and protein between young and old cells.
23599041 SVCT1 directly interacts with GRHPR.
23014846 These findings show a role for Rab8a in the physiological function of SVCT1 in intestinal epithelia.
22990596 The SVCT1 was induced and localized to the apical membrane of tubular epithelial cells.
More...

AA Sequence

MRAQEDLEGRTQHETTRDPSTPLPTEPKFDMLYKIEDVPPWYLCILLGFQHYLTCFSGTIAVPFLLAEAL      1 - 70
CVGHDQHMVSQLIGTIFTCVGITTLIQTTVGIRLPLFQASAFAFLVPAKAILALERWKCPPEEEIYGNWS     71 - 140
LPLNTSHIWHPRIREVQGAIMVSSVVEVVIGLLGLPGALLNYIGPLTVTPTVSLIGLSVFQAAGDRAGSH    141 - 210
WGISACSILLIILFSQYLRNLTFLLPVYRWGKGLTLLRIQIFKMFPIMLAIMTVWLLCYVLTLTDVLPTD    211 - 280
PKAYGFQARTDARGDIMAIAPWIRIPYPCQWGLPTVTAAAVLGMFSATLAGIIESIGDYYACARLAGAPP    281 - 350
PPVHAINRGIFTEGICCIIAGLLGTGNGSTSSSPNIGVLGITKVGSRRVVQYGAAIMLVLGTIGKFTALF    351 - 420
SSLPDPILGGMFCTLFGMITAVGLSNLQFVDMNSSRNLFVLGFSMFFGLTLPNYLESNPGAINTGILEVD    421 - 490
QILIVLLTTEMFVGGCLAFILDNTVPGSPEERGLIQWKAGAHANSDMSSSLKSYDFPIGMGIVKRITFLK    491 - 560
YIPICPVFKGFSSSSKDQIAIPEDTPENTETASVCTKV                                    561 - 598
//

Text Mined References (62)

PMID Year Title
25933589 2015 Cis-regulatory elements involved in species-specific transcriptional regulation of the SVCT1 gene in rat and human hepatoma cells.
25527764 2015 Variation in the SLC23A1 gene does not influence cardiometabolic outcomes to the extent expected given its association with L-ascorbic acid.
25416956 2014 A proteome-scale map of the human interactome network.
24815519 2014 Polymorphisms in sodium-dependent vitamin C transporter genes and plasma, aqueous humor and lens nucleus ascorbate concentrations in an ascorbate depleted setting.
24708273 2014 SLC23A1 polymorphism rs6596473 in the vitamin C transporter SVCT1 is associated with aggressive periodontitis.
24284447 2014 Polymorphisms in the sodium-dependent ascorbate transporter gene SLC23A1 are associated with susceptibility to Crohn disease.
23837633 2013 The N-terminal basolateral targeting signal unlikely acts alone in the differential trafficking of membrane transporters in MDCK cells.
23613229 2013 Senescence-induced increases in intracellular oxidative stress and enhancement of the need for ascorbic acid in human fibroblasts.
23599041 2013 Glyoxalate reductase/hydroxypyruvate reductase interacts with the sodium-dependent vitamin C transporter-1 to regulate cellular vitamin C homeostasis.
23014846 2013 Modulation of function of sodium-dependent vitamin C transporter 1 (SVCT1) by Rab8a in intestinal epithelial cells: studies utilizing Caco-2 cells and Rab8a knockout mice.
More...