Property Summary

NCBI Gene PubMed Count 49
PubMed Score 35.16
PubTator Score 30.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
atypical teratoid/rhabdoid tumor 1095 1.79960911607497E-6
medulloblastoma, large-cell 6234 6.87771657053158E-6
pediatric high grade glioma 2712 1.7842246054349E-5
osteosarcoma 7933 7.65382663170645E-5
group 3 medulloblastoma 2254 0.00105239194853336
primitive neuroectodermal tumor 3031 0.00121669577470185
ovarian cancer 8492 0.0125117018455066
oligodendroglioma 2849 0.0208924391769904
Disease Target Count Z-score Confidence
Muscular atrophy 67 4.762 2.4
Spinal muscular atrophy 24 4.135 2.1

Expression

  Differential Expression (8)

Disease log2 FC p
oligodendroglioma -1.200 0.021
osteosarcoma -1.517 0.000
group 3 medulloblastoma 1.500 0.001
medulloblastoma, large-cell 1.300 0.000
primitive neuroectodermal tumor 1.100 0.001
pediatric high grade glioma 1.100 0.000
atypical teratoid/rhabdoid tumor 1.200 0.000
ovarian cancer 1.100 0.013

Synonym

Accession Q9UHI6 B4DWV7 Q96F72 Q9NVM3 Q9UF59 Q9UIY0 Q9Y659
Symbols DP103
GEMIN3

Gene

PDB

2OXC   3B7G  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (17)

PMID Text
26064972 In stage-adjusted analysis, the nominal associations of DDX20-rs197412, PTGS2-rs5275, and HSPA5-rs391957 with DFS were detected. However, after FDR correction none of these polymorphisms remained significantly associated with the survival outcomes
25083991 DP103 defines metastatic potential of human breast cancers.
22898998 Impairment of miRNA-140 function due to a deficiency of DDX20, a miRNA machinery component, could lead to hepatocarcinogenesis
22445758 While DDX20 normally suppresses NF-kappaB activity by regulating NF-kappaB-suppressing miRNA-140 function, this suppressive effect was lost in DDX20-deficient cells.
22335944 Gemin3 binds with p53, forming a complex, and plays an anti-apoptotic role by repressing the p53 expression in Saos-2 cells.
22190034 HIV-1 Vpr is identified to have a physical interaction with DEAD (Asp-Glu-Ala-Asp) box polypeptide 20 (DDX20) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22174681 we report that EBNA3C directly interacts with Gemin3 through its C-terminal domains
21800163 NANOS1-PUMILIO2 complex, together with GEMIN3 and small noncoding RNAs, possibly regulate mRNA translation within the chromatoid body of the human germ cells.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20732906 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
More...

AA Sequence

MAAAFEASGALAAVATAMPAEHVAVQVPAPEPTPGPVRILRTAQDLSSPRTRTGDVLLAEPADFESLLLS      1 - 70
RPVLEGLRAAGFERPSPVQLKAIPLGRCGLDLIVQAKSGTGKTCVFSTIALDSLVLENLSTQILILAPTR     71 - 140
EIAVQIHSVITAIGIKMEGLECHVFIGGTPLSQDKTRLKKCHIAVGSPGRIKQLIELDYLNPGSIRLFIL    141 - 210
DEADKLLEEGSFQEQINWIYSSLPASKQMLAVSATYPEFLANALTKYMRDPTFVRLNSSDPSLIGLKQYY    211 - 280
KVVNSYPLAHKVFEEKTQHLQELFSRIPFNQALVFSNLHSRAQHLADILSSKGFPAECISGNMNQNQRLD    281 - 350
AMAKLKHFHCRVLISTDLTSRGIDAEKVNLVVNLDVPLDWETYMHRIGRAGRFGTLGLTVTYCCRGEEEN    351 - 420
MMMRIAQKCNINLLPLPDPIPSGLMEECVDWDVEVKAAVHTYGIASVPNQPLKKQIQKIERTLQIQKAHG    421 - 490
DHMASSRNNSVSGLSVKSKNNTKQKLPVKSHSECGIIEKATSPKELGCDRQSEEQMKNSVQTPVENSTNS    491 - 560
QHQVKEALPVSLPQIPCLSSFKIHQPYTLTFAELVEDYEHYIKEGLEKPVEIIRHYTGPGDQTVNPQNGF    561 - 630
VRNKVIEQRVPVLASSSQSGDSESDSDSYSSRTSSQSKGNKSYLEGSSDNQLKDSESTPVDDRISLEQPP    631 - 700
NGSDTPNPEKYQESPGIQMKTRLKEGASQRAKQSRRNLPRRSSFRLQTEAQEDDWYDCHREIRLSFSDTY    701 - 770
QDYEEYWRAYYRAWQEYYAAASHSYYWNAQRHPSWMAAYHMNTIYLQEMMHSNQ                    771 - 824
//

Text Mined References (60)

PMID Year Title
26064972 2015 A Survival Association Study of 102 Polymorphisms Previously Associated with Survival Outcomes in Colorectal Cancer.
25083991 2014 DEAD-box helicase DP103 defines metastatic potential of human breast cancers.
23752268 2013 The functional interactome landscape of the human histone deacetylase family.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22898998 2013 MicroRNA-140 acts as a liver tumor suppressor by controlling NF-?B activity by directly targeting DNA methyltransferase 1 (Dnmt1) expression.
22445758 2012 A miRNA machinery component DDX20 controls NF-?B via microRNA-140 function.
22335944 2011 [Gemin3 inhibits cell apoptosis through suppression of p53 expression].
22174681 2011 Epstein-Barr virus nuclear antigen 3C stabilizes Gemin3 to block p53-mediated apoptosis.
21800163 2011 NANOS1 and PUMILIO2 bind microRNA biogenesis factor GEMIN3, within chromatoid body in human germ cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...