Property Summary

NCBI Gene PubMed Count 52
PubMed Score 38.04
PubTator Score 30.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.200 1.8e-06
group 3 medulloblastoma 1.500 1.1e-03
medulloblastoma, large-cell 1.300 6.9e-06
oligodendroglioma -1.200 2.1e-02
osteosarcoma -1.517 7.7e-05
ovarian cancer 1.100 1.3e-02
pediatric high grade glioma 1.100 1.8e-05
primitive neuroectodermal tumor 1.100 1.2e-03

Gene RIF (18)

AA Sequence

MAAAFEASGALAAVATAMPAEHVAVQVPAPEPTPGPVRILRTAQDLSSPRTRTGDVLLAEPADFESLLLS      1 - 70
RPVLEGLRAAGFERPSPVQLKAIPLGRCGLDLIVQAKSGTGKTCVFSTIALDSLVLENLSTQILILAPTR     71 - 140
EIAVQIHSVITAIGIKMEGLECHVFIGGTPLSQDKTRLKKCHIAVGSPGRIKQLIELDYLNPGSIRLFIL    141 - 210
DEADKLLEEGSFQEQINWIYSSLPASKQMLAVSATYPEFLANALTKYMRDPTFVRLNSSDPSLIGLKQYY    211 - 280
KVVNSYPLAHKVFEEKTQHLQELFSRIPFNQALVFSNLHSRAQHLADILSSKGFPAECISGNMNQNQRLD    281 - 350
AMAKLKHFHCRVLISTDLTSRGIDAEKVNLVVNLDVPLDWETYMHRIGRAGRFGTLGLTVTYCCRGEEEN    351 - 420
MMMRIAQKCNINLLPLPDPIPSGLMEECVDWDVEVKAAVHTYGIASVPNQPLKKQIQKIERTLQIQKAHG    421 - 490
DHMASSRNNSVSGLSVKSKNNTKQKLPVKSHSECGIIEKATSPKELGCDRQSEEQMKNSVQTPVENSTNS    491 - 560
QHQVKEALPVSLPQIPCLSSFKIHQPYTLTFAELVEDYEHYIKEGLEKPVEIIRHYTGPGDQTVNPQNGF    561 - 630
VRNKVIEQRVPVLASSSQSGDSESDSDSYSSRTSSQSKGNKSYLEGSSDNQLKDSESTPVDDRISLEQPP    631 - 700
NGSDTPNPEKYQESPGIQMKTRLKEGASQRAKQSRRNLPRRSSFRLQTEAQEDDWYDCHREIRLSFSDTY    701 - 770
QDYEEYWRAYYRAWQEYYAAASHSYYWNAQRHPSWMAAYHMNTIYLQEMMHSNQ                    771 - 824
//

Text Mined References (63)

PMID Year Title