Property Summary

NCBI Gene PubMed Count 24
PubMed Score 15.77
PubTator Score 6.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma -1.700 0.000
osteosarcoma 2.038 0.000
primitive neuroectodermal tumor -1.200 0.000
Hydrolethalus syndrome -1.047 0.022
colon cancer 1.100 0.001
breast carcinoma 1.500 0.000
Breast cancer 2.600 0.039
group 3 medulloblastoma -1.500 0.000
COPD -1.100 0.014
ovarian cancer -1.200 0.000
pituitary cancer -1.200 0.001

Synonym

Gene

PANTHER Protein Class (2)

Gene RIF (11)

PMID Text
26050671 LAT1 and LAT2 are present and functional in the syncytiotrophoblast MVM, whereas LAT2 is also expressed in the BM and in the fetal capillary endothelium.
21486766 Compared with the adult cerebral cortex, mRNAs encoding OATP1A2, OATP1C1, OATP3A1 variant 2, OATP4A1, LAT2 and CD98 were reduced in fetal cortex at different gestational ages, whilst mRNAs encoding MCT8, MCT10, OATP3A1 variant 1 and LAT1 were similar.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20198315 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
17558306 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17558306 Genetic variation in LAT1 and LAT2 does not appear to be a major cause of inter-individual variability in pharmacokinetics and of adverse reactions to melphalan.
15769744 identify LAT1 and LAT2 as members of system L that mediate transmembrane movement of l-CSNO
More...

AA Sequence

MEEGARHRNNTEKKHPGGGESDASPEAGSGGGGVALKKEIGLVSACGIIVGNIIGSGIFVSPKGVLENAG      1 - 70
SVGLALIVWIVTGFITVVGALCYAELGVTIPKSGGDYSYVKDIFGGLAGFLRLWIAVLVIYPTNQAVIAL     71 - 140
TFSNYVLQPLFPTCFPPESGLRLLAAICLLLLTWVNCSSVRWATRVQDIFTAGKLLALALIIIMGIVQIC    141 - 210
KGEYFWLEPKNAFENFQEPDIGLVALAFLQGSFAYGGWNFLNYVTEELVDPYKNLPRAIFISIPLVTFVY    211 - 280
VFANVAYVTAMSPQELLASNAVAVTFGEKLLGVMAWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHL    281 - 350
PSVLAMIHVKRCTPIPALLFTCISTLLMLVTSDMYTLINYVGFINYLFYGVTVAGQIVLRWKKPDIPRPI    351 - 420
KINLLFPIIYLLFWAFLLVFSLWSEPVVCGIGLAIMLTGVPVYFLGVYWQHKPKCFSDFIELLTLVSQKM    421 - 490
CVVVYPEVERGSGTEEANEDMEEQQQPMYQPTPTKDKDVAGQPQP                             491 - 535
//

Text Mined References (27)

PMID Year Title
26050671 2015 Expression and functional characterisation of System L amino acid transporters in the human term placenta.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21486766 2011 The expression of thyroid hormone transporters in the human fetal cerebral cortex during early development and in N-Tera-2 neurodifferentiation.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
18195088 2008 Amino acid transport across mammalian intestinal and renal epithelia.
17558306 2007 Genetic polymorphisms in the amino acid transporters LAT1 and LAT2 in relation to the pharmacokinetics and side effects of melphalan.
More...