Property Summary

NCBI Gene PubMed Count 24
PubMed Score 18.81
PubTator Score 6.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (11)

Disease log2 FC p
Breast cancer 2.600 3.9e-02
breast carcinoma 1.500 1.7e-04
colon cancer 1.100 6.9e-04
COPD -1.100 1.4e-02
group 3 medulloblastoma -1.500 1.3e-04
Hydrolethalus syndrome -1.047 2.2e-02
malignant mesothelioma -1.500 5.7e-07
osteosarcoma 2.038 1.4e-04
ovarian cancer -1.200 6.7e-09
pituitary cancer -1.100 5.2e-04
primitive neuroectodermal tumor -1.200 1.2e-04

Protein-protein Interaction (1)

Gene RIF (11)

AA Sequence

MEEGARHRNNTEKKHPGGGESDASPEAGSGGGGVALKKEIGLVSACGIIVGNIIGSGIFVSPKGVLENAG      1 - 70
SVGLALIVWIVTGFITVVGALCYAELGVTIPKSGGDYSYVKDIFGGLAGFLRLWIAVLVIYPTNQAVIAL     71 - 140
TFSNYVLQPLFPTCFPPESGLRLLAAICLLLLTWVNCSSVRWATRVQDIFTAGKLLALALIIIMGIVQIC    141 - 210
KGEYFWLEPKNAFENFQEPDIGLVALAFLQGSFAYGGWNFLNYVTEELVDPYKNLPRAIFISIPLVTFVY    211 - 280
VFANVAYVTAMSPQELLASNAVAVTFGEKLLGVMAWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHL    281 - 350
PSVLAMIHVKRCTPIPALLFTCISTLLMLVTSDMYTLINYVGFINYLFYGVTVAGQIVLRWKKPDIPRPI    351 - 420
KINLLFPIIYLLFWAFLLVFSLWSEPVVCGIGLAIMLTGVPVYFLGVYWQHKPKCFSDFIELLTLVSQKM    421 - 490
CVVVYPEVERGSGTEEANEDMEEQQQPMYQPTPTKDKDVAGQPQP                             491 - 535
//

Text Mined References (27)

PMID Year Title