Property Summary

NCBI Gene PubMed Count 27
PubMed Score 26.12
PubTator Score 9.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 1.2e-04
Breast cancer -1.500 1.8e-08
fibroadenoma 1.100 4.0e-02
glioblastoma multiforme 1.100 2.9e-16
group 3 medulloblastoma 1.100 1.2e-02
medulloblastoma, large-cell 1.400 2.7e-03
Multiple myeloma 1.365 4.7e-04
ovarian cancer -2.500 4.5e-13
Pick disease -1.500 1.5e-04
primitive neuroectodermal tumor 1.700 2.5e-04
progressive supranuclear palsy -1.300 1.1e-02
psoriasis 1.100 9.5e-04
subependymal giant cell astrocytoma -1.060 1.1e-02
ulcerative colitis -1.200 2.9e-07

Protein-protein Interaction (2)

Gene RIF (8)

AA Sequence

MSPAFRAMDVEPRAKGVLLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQFYETLPAEMRKFTPQYKGVV      1 - 70
SVRFEEDEDRNLCLIAYPLKGDHGIVDIVDNSDCEPKSKLLRWTTNKKHHVLETEKTPKDWVRQHRKEEK     71 - 140
MKSHKLEEEFEWLKKSEVLYYTVEKKGNISSQLKHYNPWSMKCHQQQLQRMKENAKHRNQYKFILLENLT    141 - 210
SRYEVPCVLDLKMGTRQHGDDASEEKAANQIRKCQQSTSAVIGVRVCGMQVYQAGSGQLMFMNKYHGRKL    211 - 280
SVQGFKEALFQFFHNGRYLRRELLGPVLKKLTELKAVLERQESYRFYSSSLLVIYDGKERPEVVLDSDAE    281 - 350
DLEDLSEESADESAGAYAYKPIGASSVDVRMIDFAHTTCRLYGEDTVVHEGQDAGYIFGLQSLIDIVTEI    351 - 420
SEESGE                                                                    421 - 426
//

Text Mined References (29)

PMID Year Title