Property Summary

NCBI Gene PubMed Count 26
Grant Count 22
R01 Count 9
Funding $3,162,184.12
PubMed Score 25.57
PubTator Score 9.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Multiple myeloma 1.365 0.000
psoriasis 1.100 0.001
glioblastoma multiforme 1.100 0.000
group 3 medulloblastoma 1.300 0.002
atypical teratoid / rhabdoid tumor 1.200 0.000
medulloblastoma, large-cell 1.400 0.003
primitive neuroectodermal tumor 1.700 0.000
fibroadenoma 1.100 0.040
subependymal giant cell astrocytoma -1.060 0.011
inflammatory breast cancer -2.000 0.000
Pick disease -1.500 0.000
progressive supranuclear palsy -1.300 0.011
ulcerative colitis -1.200 0.000
ovarian cancer -2.500 0.000

Gene RIF (8)

PMID Text
24956979 An alpha-helical pair and a rare, two-turn 310 helix, that together form a substrate-binding pocket of IP6K2.
23322705 FGF2-signaling involves the inositol polyphosphate cascade, including inositol hexakisphosphate kinase (IP6K), and demonstrate that IP6K1,2 regulates Runx2 and osteoblast gene expression.
22446964 Genetic polymorphisms in IP6K2 gene is associated with autoimmune disease.
21262846 Casein kinase-2 mediates cell survival through phosphorylation and degradation of inositol hexakisphosphate kinase-2.
21078964 Gene disruption of IP6K2 in colorectal cancer cells selectively impairs p53-mediated apoptosis, instead favoring cell-cycle arrest. IP6K2 acts by binding directly to p53 and decreasing expression of proarrest gene targets
17379600 IHPK2-TRAF2 binding leads to attenuation of TAK1- and NF-kappaB-mediated signaling and is partially responsible for the apoptotic activity of IHPK2.
15533939 InsP6K2 is a physiologic mediator of cell death
11896621 IHPK2 over expression enhances sensitivity of ovarian carcinoma cells to radiation, IFN-beta, caspase 8 and DR4

AA Sequence

MSPAFRAMDVEPRAKGVLLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQFYETLPAEMRKFTPQYKGVV      1 - 70
SVRFEEDEDRNLCLIAYPLKGDHGIVDIVDNSDCEPKSKLLRWTTNKKHHVLETEKTPKDWVRQHRKEEK     71 - 140
MKSHKLEEEFEWLKKSEVLYYTVEKKGNISSQLKHYNPWSMKCHQQQLQRMKENAKHRNQYKFILLENLT    141 - 210
SRYEVPCVLDLKMGTRQHGDDASEEKAANQIRKCQQSTSAVIGVRVCGMQVYQAGSGQLMFMNKYHGRKL    211 - 280
SVQGFKEALFQFFHNGRYLRRELLGPVLKKLTELKAVLERQESYRFYSSSLLVIYDGKERPEVVLDSDAE    281 - 350
DLEDLSEESADESAGAYAYKPIGASSVDVRMIDFAHTTCRLYGEDTVVHEGQDAGYIFGLQSLIDIVTEI    351 - 420
SEESGE                                                                    421 - 426
//

Text Mined References (28)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25082827 2014 A genome-wide association study identifies a novel locus at 6q22.1 associated with ulcerative colitis.
24956979 2014 IP6K structure and the molecular determinants of catalytic specificity in an inositol phosphate kinase family.
23322705 2013 The regulation of runt-related transcription factor 2 by fibroblast growth factor-2 and connexin43 requires the inositol polyphosphate/protein kinase C? cascade.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22446964 2012 Genetics of gene expression in primary immune cells identifies cell type-specific master regulators and roles of HLA alleles.
21262846 2011 Casein kinase-2 mediates cell survival through phosphorylation and degradation of inositol hexakisphosphate kinase-2.
21078964 2010 p53-mediated apoptosis requires inositol hexakisphosphate kinase-2.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...