Property Summary

NCBI Gene PubMed Count 15
PubMed Score 4.78
PubTator Score 8.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
autosomal dominant Emery-Dreifuss muscul... -1.159 4.0e-02
Breast cancer 1.900 4.9e-02
breast carcinoma -1.300 5.4e-04
ductal carcinoma in situ -1.800 4.2e-04
fibroadenoma -1.400 4.3e-02
interstitial lung disease -1.100 9.5e-03
invasive ductal carcinoma -1.600 6.6e-03
lung adenocarcinoma -1.100 4.1e-15
lung cancer -1.100 4.6e-03
malignant mesothelioma -2.500 2.4e-07
medulloblastoma -1.100 6.6e-03
medulloblastoma, large-cell -1.400 3.2e-03
osteosarcoma 3.066 2.3e-05
ovarian cancer -1.500 1.3e-04
pancreatic ductal adenocarcinoma liver m... -1.860 5.1e-03
Pick disease 1.400 2.2e-03

Gene RIF (2)

AA Sequence

MGRVVAELVSSLLGLWLLLCSCGCPEGAELRAPPDKIAIIGAGIGGTSAAYYLRQKFGKDVKIDLFEREE      1 - 70
VGGRLATMMVQGQEYEAGGSVIHPLNLHMKRFVKDLGLSAVQASGGLLGIYNGETLVFEESNWFIINVIK     71 - 140
LVWRYGFQSLRMHMWVEDVLDKFMRIYRYQSHDYAFSSVEKLLHALGGDDFLGMLNRTLLETLQKAGFSE    141 - 210
KFLNEMIAPVMRVNYGQSTDINAFVGAVSLSCSDSGLWAVEGGNKLVCSGLLQASKSNLISGSVMYIEEK    211 - 280
TKTKYTGNPTKMYEVVYQIGTETRSDFYDIVLVATPLNRKMSNITFLNFDPPIEEFHQYYQHIVTTLVKG    281 - 350
ELNTSIFSSRPIDKFGLNTVLTTDNSDLFINSIGIVPSVREKEDPEPSTDGTYVWKIFSQETLTKAQILK    351 - 420
LFLSYDYAVKKPWLAYPHYKPPEKCPSIILHDRLYYLNGIECAASAMEMSAIAAHNAALLAYHRWNGHTD    421 - 490
MIDQDGLYEKLKTEL                                                           491 - 505
//

Text Mined References (21)

PMID Year Title