Property Summary

NCBI Gene PubMed Count 15
Grant Count 5
R01 Count 5
Funding $747,223.5
PubMed Score 3.78
PubTator Score 8.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
interstitial lung disease -1.100 0.010
malignant mesothelioma -2.500 0.000
osteosarcoma 3.066 0.000
medulloblastoma -1.100 0.007
medulloblastoma, large-cell -1.700 0.000
autosomal dominant Emery-Dreifuss muscul... -1.159 0.040
pancreatic ductal adenocarcinoma liver m... -1.860 0.005
lung cancer -1.100 0.005
breast carcinoma -1.300 0.001
fibroadenoma -1.400 0.043
Breast cancer 1.900 0.049
lung adenocarcinoma -1.700 0.000
Pick disease 1.400 0.002
ductal carcinoma in situ -1.800 0.000
invasive ductal carcinoma -1.600 0.007
ovarian cancer -1.800 0.000

Gene RIF (2)

PMID Text
19253276 Addition of the substrate farnesylcysteine to lipoprotein resulted in a time-dependent generation of H(2)O(2) which was stronger in very low density lipoprotein (VLDL) than in LDL or HDL, reflecting the greater protein content of PCL1 in VLDL.
12186880 initial studies of the kinetic mechanism and stereospecificity of this unusual enzyme

AA Sequence

MGRVVAELVSSLLGLWLLLCSCGCPEGAELRAPPDKIAIIGAGIGGTSAAYYLRQKFGKDVKIDLFEREE      1 - 70
VGGRLATMMVQGQEYEAGGSVIHPLNLHMKRFVKDLGLSAVQASGGLLGIYNGETLVFEESNWFIINVIK     71 - 140
LVWRYGFQSLRMHMWVEDVLDKFMRIYRYQSHDYAFSSVEKLLHALGGDDFLGMLNRTLLETLQKAGFSE    141 - 210
KFLNEMIAPVMRVNYGQSTDINAFVGAVSLSCSDSGLWAVEGGNKLVCSGLLQASKSNLISGSVMYIEEK    211 - 280
TKTKYTGNPTKMYEVVYQIGTETRSDFYDIVLVATPLNRKMSNITFLNFDPPIEEFHQYYQHIVTTLVKG    281 - 350
ELNTSIFSSRPIDKFGLNTVLTTDNSDLFINSIGIVPSVREKEDPEPSTDGTYVWKIFSQETLTKAQILK    351 - 420
LFLSYDYAVKKPWLAYPHYKPPEKCPSIILHDRLYYLNGIECAASAMEMSAIAAHNAALLAYHRWNGHTD    421 - 490
MIDQDGLYEKLKTEL                                                           491 - 505
//

Text Mined References (21)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
19253276 2009 Proteomic analysis of human low-density lipoprotein reveals the presence of prenylcysteine lyase, a hydrogen peroxide-generating enzyme.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17154273 2007 Proteomic analysis of human very low-density lipoprotein by two-dimensional gel electrophoresis and MALDI-TOF/TOF.
16765319 2006 Downregulation of two novel genes in Sl/Sld and W(LacZ)/Wv mouse jejunum.
More...