Property Summary

NCBI Gene PubMed Count 58
Grant Count 49
R01 Count 21
Funding $6,613,874.76
PubMed Score 47.25
PubTator Score 123.71

Knowledge Summary

Patent

No data available

Expression

Gene RIF (46)

PMID Text
27100778 DCDC2 Polymorphism is associated with reading disability.
26331477 off-target, non-immune mediated effects of the mTOR-inhibitor everolimus on the podocyte cytoskeleton might involve regulation of microtubules, revealing a potential novel role of TUBB2B and DCDC2 in glomerular podocyte development
26019324 In a population carrying a deletion in the DCDC2 gene, impaired motion perception was identified in subjects with dyslexia.
25877001 A nonsynonymous polymorphism in DCDC2 (corrected P = 0.002) and a noncoding variant in S100B (corrected P = 0.016) showed a significant association with spelling performance in families of German origin.
25601850 Our results reveal DCDC2a to be a deafness gene and a player in hair cell kinocilia and supporting cell primary cilia length regulation likely via its role in microtubule formation and stabilization.
25557784 DCDC2 interacts with the mediator of Wnt signaling dishevelled, and that DCDC2 overexpression inhibits beta-catenin-dependent Wnt signaling; central role of Wnt signaling in the pathogenesis of nephronophthisis-related ciliopathies
25339756 An SNP in DCDC2 (rs793842) was significantly associated with the thickness of the left temporoparietal cortex.
25270309 This study demonstrated that DCDC2 intron 2 deletion impair illusory visual motion perception-specifically processed by the magnocellular-dorsal (M-D) stream-is impaired in children with Developmental dyslexia.
25230923 the association of DCDC2 and KIAA0319 with Developmental dyslexia in Chinese population should be further validated
25012462 Among children exposed to low socioeconomic level, READ1 [regulatory element associated with dyslexia 1 ] genetic variant targets the worst outcome in children's attention.
More...

AA Sequence

MSGSSARSSHLSQPVVKSVLVYRNGDPFYAGRRVVIHEKKVSSFEVFLKEVTGGVQAPFGAVRNIYTPRT      1 - 70
GHRIRKLDQIQSGGNYVAGGQEAFKKLNYLDIGEIKKRPMEVVNTEVKPVIHSRINVSARFRKPLQEPCT     71 - 140
IFLIANGDLINPASRLLIPRKTLNQWDHVLQMVTEKITLRSGAVHRLYTLEGKLVESGAELENGQFYVAV    141 - 210
GRDKFKKLPYSELLFDKSTMRRPFGQKASSLPPIVGSRKSKGSGNDRHSKSTVGSSDNSSPQPLKRKGKK    211 - 280
EDVNSEKLTKLKQNVKLKNSQETIPNSDEGIFKAGAERSETRGAAEVQEDEDTQVEVPVDQRPAEIVDEE    281 - 350
EDGEKANKDAEQKEDFSGMNGDLEEEGGREATDAPEQVEEILDHSEQQARPARVNGGTDEENGEELQQVN    351 - 420
NELQLVLDKERKSQGAGSGQDEADVDPQRPPRPEVKITSPEENENNQQNKDYAAVA                  421 - 476
//

Text Mined References (58)

PMID Year Title
27319779 2016 DCDC2 Mutations Cause Neonatal Sclerosing Cholangitis.
27100778 2016 Association of DCDC2 Polymorphisms with Normal Variations in Reading Abilities in a Chinese Population.
26331477 2015 Everolimus Stabilizes Podocyte Microtubules via Enhancing TUBB2B and DCDC2 Expression.
26019324 2015 Strong motion deficits in dyslexia associated with DCDC2 gene alteration.
25877001 2015 Polymorphisms in DCDC2 and S100B associate with developmental dyslexia.
25601850 2015 A missense mutation in DCDC2 causes human recessive deafness DFNB66, likely by interfering with sensory hair cell and supporting cell cilia length regulation.
25557784 2015 DCDC2 mutations cause a renal-hepatic ciliopathy by disrupting Wnt signaling.
25416956 2014 A proteome-scale map of the human interactome network.
25339756 2014 DCDC2 polymorphism is associated with left temporoparietal gray and white matter structures during development.
25270309 2015 The DCDC2 intron 2 deletion impairs illusory motion perception unveiling the selective role of magnocellular-dorsal stream in reading (dis)ability.
More...