Property Summary

NCBI Gene PubMed Count 60
PubMed Score 52.43
PubTator Score 123.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (14)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.400 4.6e-02
Breast cancer -2.900 1.2e-13
chronic rhinosinusitis -1.944 1.5e-02
cystic fibrosis -2.484 3.6e-06
ependymoma 2.400 3.0e-07
interstitial cystitis -1.500 4.4e-03
intraductal papillary-mucinous adenoma (... -1.400 9.9e-03
intraductal papillary-mucinous carcinoma... -1.800 4.0e-02
intraductal papillary-mucinous neoplasm ... -2.000 1.5e-02
lung adenocarcinoma -1.300 2.7e-12
non-small cell lung cancer -1.293 1.2e-20
ovarian cancer 2.600 5.4e-05
pituitary cancer 2.600 6.4e-06
urothelial carcinoma -1.600 2.8e-02

 GO Function (1)

Gene RIF (49)

AA Sequence

MSGSSARSSHLSQPVVKSVLVYRNGDPFYAGRRVVIHEKKVSSFEVFLKEVTGGVQAPFGAVRNIYTPRT      1 - 70
GHRIRKLDQIQSGGNYVAGGQEAFKKLNYLDIGEIKKRPMEVVNTEVKPVIHSRINVSARFRKPLQEPCT     71 - 140
IFLIANGDLINPASRLLIPRKTLNQWDHVLQMVTEKITLRSGAVHRLYTLEGKLVESGAELENGQFYVAV    141 - 210
GRDKFKKLPYSELLFDKSTMRRPFGQKASSLPPIVGSRKSKGSGNDRHSKSTVGSSDNSSPQPLKRKGKK    211 - 280
EDVNSEKLTKLKQNVKLKNSQETIPNSDEGIFKAGAERSETRGAAEVQEDEDTQVEVPVDQRPAEIVDEE    281 - 350
EDGEKANKDAEQKEDFSGMNGDLEEEGGREATDAPEQVEEILDHSEQQARPARVNGGTDEENGEELQQVN    351 - 420
NELQLVLDKERKSQGAGSGQDEADVDPQRPPRPEVKITSPEENENNQQNKDYAAVA                  421 - 476
//

Text Mined References (61)

PMID Year Title