Property Summary

NCBI Gene PubMed Count 67
PubMed Score 98.45
PubTator Score 102.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (7)

Disease Target Count P-value
lung carcinoma 2844 1.55259813813214E-29
posterior fossa group A ependymoma 1511 1.06252750550943E-11
malignant mesothelioma 3163 1.00149621384528E-7
glioblastoma 5572 2.83592713566819E-6
group 4 medulloblastoma 1875 2.97046146093177E-6
atypical teratoid / rhabdoid tumor 4369 3.12517802622998E-6
osteosarcoma 7933 5.22230648652846E-6
lung cancer 4473 2.88579804168737E-5
ovarian cancer 8492 9.95602948487595E-5
pituitary cancer 1972 1.9548413642733E-4
Pick disease 1893 2.03587110849708E-4
pediatric high grade glioma 2712 5.10921624527053E-4
breast carcinoma 1614 7.8048491203361E-4
tuberculosis and treatment for 3 months 327 0.00228613844486141
astrocytic glioma 2241 0.00278597538302898
medulloblastoma, large-cell 6234 0.00585434529696432
colon cancer 1475 0.0110311781302516
oligodendroglioma 2849 0.0178211985106039
Breast cancer 3099 0.0248609387717636
invasive ductal carcinoma 2950 0.0293906876367069
ductal carcinoma in situ 1745 0.0309652643227638
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0479535981554598
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Kidney cancer 121 0.0 1.0
Disease Target Count Z-score Confidence
Rheumatoid Arthritis 1171 0.0 2.0

Expression

  Differential Expression (23)

Disease log2 FC p
Rheumatoid Arthritis 1.600 0.009
malignant mesothelioma -2.400 0.000
astrocytic glioma 1.500 0.003
posterior fossa group A ependymoma 2.600 0.000
oligodendroglioma 1.400 0.018
osteosarcoma 3.120 0.000
atypical teratoid / rhabdoid tumor 1.200 0.000
glioblastoma 2.100 0.000
medulloblastoma, large-cell -2.200 0.006
tuberculosis and treatment for 3 months -1.300 0.002
intraductal papillary-mucinous carcinoma... -1.500 0.048
lung cancer 2.300 0.000
colon cancer -1.700 0.011
breast carcinoma 1.800 0.001
Breast cancer 4.500 0.025
pediatric high grade glioma 1.400 0.001
group 4 medulloblastoma -2.500 0.000
lung carcinoma -2.000 0.000
Pick disease 1.500 0.000
ductal carcinoma in situ 1.800 0.031
invasive ductal carcinoma 2.000 0.029
ovarian cancer 2.400 0.000
pituitary cancer -1.300 0.000

Synonym

Accession Q9UHF7 B4E1Z5 Q08AU2 Q9NWE1 Q9UHH6
Symbols GC79
LGCR

Gene

PANTHER Protein Class (2)

  Ortholog (11)

Pathway (1)

Gene RIF (48)

PMID Text
26377811 Trps1 plays a crucial role in osteosarcoma angiogenesis, metastasis and clinical surgical stage.
26183398 Data show that co-silencing of tricho-rhino-phalangeal-syndrome (TRPS1) and cathepsin D (Cath-D) in breast cancer cells (BCC) affects the transcription of cell cycle and proliferation.
25886207 Trps1 is involved in non-anastomotic biliary structure pathogenesis following liver transplantation and negatively correlates with biliary epithelial cell epithelial-mesenchymal transition and biliary fibrosis in liver grafts.
25792522 Missense mutations are located exclusively in exon 6 and 7 of TRPS1 in patients with tricho-rhino-phalangeal syndrome.
25333908 Identification of a novel missense mutation c.2726G>A (p.C909Y) of the TRPS1 gene in a family with trichorhinophalangeal syndrome type I.
25328121 Single nucleotide polymorphisms in TRPS1 gene is associated with Coronary Artery Disease.
25277197 our study proposes that TRPS1 acts as a central hub in the control of cell cycle and proliferation during cancer development
25136899 TRPS1 haploinsufficiency results in STAT3 and SOX9 mRNA expression in Trichorhinophalangeal syndrome.
25128529 Trps1 is required for odontoblast maturation by supporting expression of genes crucial for initiating the mineralization process.
24934762 TRPS1 gene expressionis associated with different epithelial mesenchymal transformation markers in ERalpha-positive and ERalpha-negative breast cancers.
More...

AA Sequence

MVRKKNPPLRNVASEGEGQILEPIGTESKVSGKNKEFSADQMSENTDQSDAAELNHKEEHSLHVQDPSSS      1 - 70
SKKDLKSAVLSEKAGFNYESPSKGGNFPSFPHDEVTDRNMLAFSSPAAGGVCEPLKSPQRAEADDPQDMA     71 - 140
CTPSGDSLETKEDQKMSPKATEETGQAQSGQANCQGLSPVSVASKNPQVPSDGGVRLNKSKTDLLVNDNP    141 - 210
DPAPLSPELQDFKCNICGYGYYGNDPTDLIKHFRKYHLGLHNRTRQDAELDSKILALHNMVQFSHSKDFQ    211 - 280
KVNRSVFSGVLQDINSSRPVLLNGTYDVQVTSGGTFIGIGRKTPDCQGNTKYFRCKFCNFTYMGNSSTEL    281 - 350
EQHFLQTHPNKIKASLPSSEVAKPSEKNSNKSIPALQSSDSGDLGKWQDKITVKAGDDTPVGYSVPIKPL    351 - 420
DSSRQNGTEATSYYWCKFCSFSCESSSSLKLLEHYGKQHGAVQSGGLNPELNDKLSRGSVINQNDLAKSS    421 - 490
EGETMTKTDKSSSGAKKKDFSSKGAEDNMVTSYNCQFCDFRYSKSHGPDVIVVGPLLRHYQQLHNIHKCT    491 - 560
IKHCPFCPRGLCSPEKHLGEITYPFACRKSNCSHCALLLLHLSPGAAGSSRVKHQCHQCSFTTPDVDVLL    561 - 630
FHYESVHESQASDVKQEANHLQGSDGQQSVKESKEHSCTKCDFITQVEEEISRHYRRAHSCYKCRQCSFT    631 - 700
AADTQSLLEHFNTVHCQEQDITTANGEEDGHAISTIKEEPKIDFRVYNLLTPDSKMGEPVSESVVKREKL    701 - 770
EEKDGLKEKVWTESSSDDLRNVTWRGADILRGSPSYTQASLGLLTPVSGTQEQTKTLRDSPNVEAAHLAR    771 - 840
PIYGLAVETKGFLQGAPAGGEKSGALPQQYPASGENKSKDESQSLLRRRRGSGVFCANCLTTKTSLWRKN    841 - 910
ANGGYVCNACGLYQKLHSTPRPLNIIKQNNGEQIIRRRTRKRLNPEALQAEQLNKQQRGSNEEQVNGSPL    911 - 980
ERRSEDHLTESHQREIPLPSLSKYEAQGSLTKSHSAQQPVLVSQTLDIHKRMQPLHIQIKSPQESTGDPG    981 - 1050
NSSSVSEGKGSSERGSPIEKYMRPAKHPNYSPPGSPIEKYQYPLFGLPFVHNDFQSEADWLRFWSKYKLS   1051 - 1120
VPGNPHYLSHVPGLPNPCQNYVPYPTFNLPPHFSAVGSDNDIPLDLAIKHSRPGPTANGASKEKTKAPPN   1121 - 1190
VKNEGPLNVVKTEKVDRSTQDELSTKCVHCGIVFLDEVMYALHMSCHGDSGPFQCSICQHLCTDKYDFTT   1191 - 1260
HIQRGLHRNNAQVEKNGKPKE                                                    1261 - 1281
//

Text Mined References (78)

PMID Year Title
26377811 2015 Overexpression of Trps1 contributes to tumor angiogenesis and poor prognosis of human osteosarcoma.
26183398 2015 Nuclear cathepsin D enhances TRPS1 transcriptional repressor function to regulate cell cycle progression and transformation in human breast cancer cells.
25886207 2015 Trps1 regulates biliary epithelial-mesenchymal transition and has roles during biliary fibrosis in liver grafts: a preliminary study.
25792522 2015 Phenotype and genotype in 103 patients with tricho-rhino-phalangeal syndrome.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25333908 2015 Trichorhinophalangeal syndrome type I: a novel mutation and Perthes-like changes of the hip in a family with 4 cases over 3 generations.
25328121 2015 Associations between Genetic Variants and Angiographic Characteristics in Patients with Coronary Artery Disease.
25277197 2014 A central role for TRPS1 in the control of cell cycle and cancer development.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
More...