Property Summary

NCBI Gene PubMed Count 15
Grant Count 4
R01 Count 4
Funding $405,405.68
PubMed Score 12.04
PubTator Score 33.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
inflammatory breast cancer 404

Expression

  Differential Expression (1)

Disease log2 FC p
inflammatory breast cancer -3.500 0.000

Gene RIF (9)

PMID Text
26285835 Studies indicate that interleukin 17 (IL-17B)/interleukin 17 receptor B (IL-17RB) signaling is essential for pancreatic cancer malignancy.
25732306 IL-17B-IL-17RB signaling promotes pancreatic cancer malignancy.
24056520 IL-17B can enhance the effects of TNF-alpha on the production of cytokines and chemokines that control immune cell trafficking and neutrophil homeostasis in the inflamed tissues.
23851503 Results show that amplified signaling of interleukin-17 receptor B (IL-17RB) and its ligand IL-17B promot tumorigenicity in breast cancer cells and impeded acinus formation in immortalized normal mammary epithelial cells.
23661335 IL-17A, IL-17B, IL-17F and IL-23 in systemic lupus erythematosus patients were examined and the correlation between levels of the investigated cytokines and VEGF, PIGF, as well as number of endothelial cells, was investigated.
22394632 expression and functional study of IL-17B
19845895 Observational study of gene-disease association. (HuGE Navigator)
16805377 IL-17 may play an important role in the occurrence of nasal polyps by overexpression.
15713213 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDWPHNLLFLLTISIFLGLGQPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMV      1 - 70
AQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVS     71 - 140
VPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF                                  141 - 180
//

Text Mined References (15)

PMID Year Title
26285835 2015 Targeting interleukin-17 receptors.
25732306 2015 Targeting IL-17B-IL-17RB signaling with an anti-IL-17RB antibody blocks pancreatic cancer metastasis by silencing multiple chemokines.
24056520 2014 Neutrophils produce interleukin-17B in rheumatoid synovial tissue.
23851503 2014 Autocrine/paracrine mechanism of interleukin-17B receptor promotes breast tumorigenesis through NF-?B-mediated antiapoptotic pathway.
23661335 2013 Correlations between concentrations of interleukin (IL)-17A, IL-17B and IL-17F, and endothelial cells and proangiogenic cytokines in systemic lupus erythematosus patients.
22394632 2012 [Eukaryotic expression and biological activity of recombinant human IL-17B protein].
19845895 2009 Fine mapping of the CELIAC2 locus on chromosome 5q31-q33 in the Finnish and Hungarian populations.
16805377 2006 Expression profile of immune-associated genes in nasal polyps.
15713213 2005 Chromosome 5q candidate genes in coeliac disease: genetic variation at IL4, IL5, IL9, IL13, IL17B and NR3C1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...