Property Summary

NCBI Gene PubMed Count 18
PubMed Score 14.90
PubTator Score 33.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
inflammatory breast cancer 286 7.5e-08

Expression

  Differential Expression (1)

Disease log2 FC p
inflammatory breast cancer -3.500 7.5e-08

Synonym

Accession Q9UHF5 Q14CE5 IL-17B
Symbols NIRF
IL-20
IL-17B
ZCYTO7

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (12)

AA Sequence

MDWPHNLLFLLTISIFLGLGQPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMV      1 - 70
AQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVS     71 - 140
VPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF                                  141 - 180
//

Text Mined References (18)

PMID Year Title