Property Summary

NCBI Gene PubMed Count 26
PubMed Score 22.55
PubTator Score 17.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Abortion, Spontaneous 109 0.0 0.0
Disease Target Count
Spontaneous abortion 113
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (15)

Disease log2 FC p
psoriasis -1.700 6.6e-08
adrenocortical carcinoma -1.128 6.3e-03
aldosterone-producing adenoma -1.229 3.0e-02
Atopic dermatitis -1.400 7.0e-04
Breast cancer -2.200 2.9e-06
breast carcinoma -1.100 3.0e-12
cystic fibrosis -1.100 1.1e-04
ependymoma 2.300 1.1e-05
fibroadenoma 1.700 8.3e-03
interstitial cystitis -2.700 2.2e-03
lung adenocarcinoma -1.600 3.1e-11
lung cancer -1.900 3.6e-04
lung carcinoma 2.300 4.6e-15
non-small cell lung cancer -1.285 5.7e-09
ovarian cancer 1.400 1.6e-03

 GWAS Trait (1)

Gene RIF (14)

AA Sequence

MRAPGRPALRPLPLPPLLLLLLAAPWGRAVPCVSGGLPKPANITFLSINMKNVLQWTPPEGLQGVKVTYT      1 - 70
VQYFIYGQKKWLNKSECRNINRTYCDLSAETSDYEHQYYAKVKAIWGTKCSKWAESGRFYPFLETQIGPP     71 - 140
EVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEP    141 - 210
NTLYCVHVESFVPGPPRRAQPSEKQCARTLKDQSSEFKAKIIFWYVLPVSITVFLFSVMGYSIYRYIHVG    211 - 280
KEKHPANLILIYGNEFDKRFFVPAEKIVINFITLNISDDSKISHQDMSLLGKSSDVSSLNDPQPSGNLRP    281 - 350
PQEEEEVKHLGYASHLMEIFCDSEENTEGTSLTQQESLSRTIPPDKTVIEYEYDVRTTDICAGPEEQELS    351 - 420
LQEEVSTQGTLLESQAALAVLGPQTLQYSYTPQLQDLDPLAQEHTDSEEGPEEEPSTTLVDWDPQTGRLC    421 - 490
IPSLSSFDQDSEGCEPSEGDGLGEEGLLSRLYEEPAPDRPPGENETYLMQFMEEWGLYVQMEN           491 - 553
//

Text Mined References (27)

PMID Year Title