Property Summary

NCBI Gene PubMed Count 24
PubMed Score 21.33
PubTator Score 17.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Spontaneous abortion 108
Disease Target Count P-value
lung carcinoma 2844 4.6258105664476E-15
breast carcinoma 1614 3.0151847423528E-12
lung adenocarcinoma 2714 3.05426223704647E-11
non-small cell lung cancer 2798 5.67528751037105E-9
Breast cancer 3099 2.44151596969584E-7
posterior fossa group B ependymoma 1530 1.24692460219275E-6
interstitial cystitis 2299 2.52220729451686E-5
cystic fibrosis 1670 1.1027637433948E-4
lung cancer 4473 3.56611548687773E-4
Atopic dermatitis 944 6.95754208990915E-4
ovarian cancer 8492 0.00158851234410375
adrenocortical carcinoma 1427 0.00632633718665986
fibroadenoma 557 0.00829202079250882
aldosterone-producing adenoma 664 0.0304491868712544
Disease Target Count Z-score Confidence
psoriasis 6685 3.969 2.0

Expression

  Differential Expression (15)

Disease log2 FC p
psoriasis -1.700 0.000
posterior fossa group B ependymoma 2.400 0.000
Atopic dermatitis -1.400 0.001
adrenocortical carcinoma -1.128 0.006
non-small cell lung cancer -1.285 0.000
lung cancer -1.900 0.000
fibroadenoma 1.700 0.008
interstitial cystitis -3.400 0.000
cystic fibrosis -1.100 0.000
lung adenocarcinoma -1.600 0.000
aldosterone-producing adenoma -1.229 0.030
Breast cancer -2.400 0.000
lung carcinoma 2.300 0.000
breast carcinoma -1.100 0.000
ovarian cancer 1.400 0.002

Synonym

Accession Q9UHF4 B4DLR5 F5H675 Q14CW2 Q6UWA9 Q96SH8 IL-20 receptor subunit alpha
Symbols CRF2-8
IL-20R1
IL-20RA
IL-20R-alpha

Gene

PDB

4DOH  

  Ortholog (10)

Gene RIF (13)

PMID Text
26977011 IL20R1 correlated with prognosis of patients with pancreatic cancer, and mediates pancreatic cancer cell growth and migration. It may be a potential biomarker for IL24 molecular-targeted therapy.
22232181 crystallographic asymmetric unit contains one IL-20-IL-20R1-IL-20R2 complex, corresponding to a solvent content of approximately 54%
20800603 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19926456 IL-20RA polymorphisms may have a role in psoriasis
19926456 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19666410 Complete mda-7/IL-24 receptors (IL-22R1/IL-20R2 and IL-20R1/IL-20R2) are seldom expressed in liver cancer cell lines.
18480827 The hypotheses that genetic variations of the IL-20-RI influence susceptibility to psoriasis was investigated.
More...

AA Sequence

MRAPGRPALRPLPLPPLLLLLLAAPWGRAVPCVSGGLPKPANITFLSINMKNVLQWTPPEGLQGVKVTYT      1 - 70
VQYFIYGQKKWLNKSECRNINRTYCDLSAETSDYEHQYYAKVKAIWGTKCSKWAESGRFYPFLETQIGPP     71 - 140
EVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEP    141 - 210
NTLYCVHVESFVPGPPRRAQPSEKQCARTLKDQSSEFKAKIIFWYVLPVSITVFLFSVMGYSIYRYIHVG    211 - 280
KEKHPANLILIYGNEFDKRFFVPAEKIVINFITLNISDDSKISHQDMSLLGKSSDVSSLNDPQPSGNLRP    281 - 350
PQEEEEVKHLGYASHLMEIFCDSEENTEGTSLTQQESLSRTIPPDKTVIEYEYDVRTTDICAGPEEQELS    351 - 420
LQEEVSTQGTLLESQAALAVLGPQTLQYSYTPQLQDLDPLAQEHTDSEEGPEEEPSTTLVDWDPQTGRLC    421 - 490
IPSLSSFDQDSEGCEPSEGDGLGEEGLLSRLYEEPAPDRPPGENETYLMQFMEEWGLYVQMEN           491 - 553
//

Text Mined References (26)

PMID Year Title
26977011 2016 IL24 and its Receptors Regulate Growth and Migration of Pancreatic Cancer Cells and Are Potential Biomarkers for IL24 Molecular Therapy.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
22802649 2012 Structural basis for receptor sharing and activation by interleukin-20 receptor-2 (IL-20R2) binding cytokines.
22232181 2012 Purification, crystallization and preliminary X-ray diffraction analysis of the IL-20-IL-20R1-IL-20R2 complex.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19926456 2010 Further association analysis of chr 6q22-24 suggests a role of IL-20RA polymorphisms in psoriasis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19666410 2009 Expression pattern of mda-7/IL-24 receptors in liver cancer cell lines.
More...